KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029260
Entry
101029260         CDS       T04350                                 

Gene name
CRK
Definition
(RefSeq) adapter molecule crk
  KO
K04438  C-crk adapter molecule crk
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04015  Rap1 signaling pathway
sbq04062  Chemokine signaling pathway
sbq04510  Focal adhesion
sbq04666  Fc gamma R-mediated phagocytosis
sbq04722  Neurotrophin signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
sbq05100  Bacterial invasion of epithelial cells
sbq05135  Yersinia infection
sbq05163  Human cytomegalovirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05206  MicroRNAs in cancer
sbq05211  Renal cell carcinoma
sbq05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101029260 (CRK)
   04012 ErbB signaling pathway
    101029260 (CRK)
   04015 Rap1 signaling pathway
    101029260 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101029260 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101029260 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101029260 (CRK)
   04062 Chemokine signaling pathway
    101029260 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101029260 (CRK)
   04935 Growth hormone synthesis, secretion and action
    101029260 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101029260 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101029260 (CRK)
   05206 MicroRNAs in cancer
    101029260 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101029260 (CRK)
   05211 Renal cell carcinoma
    101029260 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101029260 (CRK)
   05100 Bacterial invasion of epithelial cells
    101029260 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101029260 (CRK)
   05163 Human cytomegalovirus infection
    101029260 (CRK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sbq04990]
    101029260 (CRK)
Domain-containing proteins not elsewhere classified [BR:sbq04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   101029260 (CRK)
SSDB
Motif
Pfam: SH3_2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 101029260
NCBI-ProteinID: XP_010338344
LinkDB
Position
Unknown
AA seq 226 aa
FPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVR
ALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVS
ALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALAL
EVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS
NT seq 681 nt   +upstreamnt  +downstreamnt
tttccaggggtgagcccctccagactccgaataggagatcaagagttcgattcattgcct
gctttactggaattctacaaaatacactatttggacactacaacgttgatagaaccggtt
tccagatccaggcagggtagtggagtgattctcaggcaggaggaggcggagtatgtgcga
gccctctttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatc
ctgagaatccgggataagcctgaagagcagtggtggaatgcagaggacagcgaaggcaag
agggggatgatcccagtcccttacgtcgagaagtatagacccgcctccgcctcagtgtcg
gctctgattggaggtaaccaggagggttcccacccgcagccactgggtgggccggagccg
gggccctatgcgcaacccagcgtcaacactccgctccctaacctccagaatgggcccata
tatgccagggttatccagaagcgagtccccaatgcctacgacaagacagccttggctttg
gaggtcggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggag
tgcaatggcaaacgaggtcacttccctttcacacatgtccgtctgctggatcaacagaat
cccgatgaggacttcagctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051048
Entry
101051048         CDS       T04350                                 

Gene name
CRKL
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04015  Rap1 signaling pathway
sbq04062  Chemokine signaling pathway
sbq04510  Focal adhesion
sbq04666  Fc gamma R-mediated phagocytosis
sbq04722  Neurotrophin signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
sbq05100  Bacterial invasion of epithelial cells
sbq05135  Yersinia infection
sbq05163  Human cytomegalovirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05206  MicroRNAs in cancer
sbq05211  Renal cell carcinoma
sbq05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101051048 (CRKL)
   04012 ErbB signaling pathway
    101051048 (CRKL)
   04015 Rap1 signaling pathway
    101051048 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101051048 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101051048 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101051048 (CRKL)
   04062 Chemokine signaling pathway
    101051048 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101051048 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    101051048 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101051048 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101051048 (CRKL)
   05206 MicroRNAs in cancer
    101051048 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101051048 (CRKL)
   05211 Renal cell carcinoma
    101051048 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101051048 (CRKL)
   05100 Bacterial invasion of epithelial cells
    101051048 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101051048 (CRKL)
   05163 Human cytomegalovirus infection
    101051048 (CRKL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sbq04990]
    101051048 (CRKL)
Domain-containing proteins not elsewhere classified [BR:sbq04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   101051048 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 101051048
NCBI-ProteinID: XP_003942698
UniProt: A0A2K6TEM2
LinkDB
Position
Unknown
AA seq 303 aa
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPSLPT
AEENLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPIPAVSGSPGAAITPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
ENE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcctccgccaggttcgactcctcggaccgctctgcctggtacatggggccggtgtct
cgccaggaggcgcagacccggctccagggccagcgccacggtatgttcctcgtccgcgac
tcttccacctgccctggggactatgtgctctcggtgtccgagaactcgcgggtctcccac
tacatcatcaactcgctgcccaaccgtcgttttaagatcggggaccaggagtttgaccat
ttgccggccctgctggagttttacaagatccactacctggacaccaccacgctcatcgag
ccggcgcccaggtatccaagcccaccaatgggatctgtctcagcacccagcctgcctaca
gcagaggaaaacctggaatatgtacggactctgtatgattttcctggaaatgatgcagaa
gacttgccctttaaaaagggtgagatcctagtgataatagagaagcctgaagaacagtgg
tggagtgcccggaacaaggatggccgggttgggatgattcctgtcccttacgtcgaaaag
cttgtgagatcctcaccacatggaaagcatggaaataggaattccaacagttatgggatc
ccagaacctgctcatgcgtacgcccaacctcagaccacaactcctatacctgcagtttct
ggttctcctggggcagcaatcacccctttgccatcgactcagaatggacctgtctttgcg
aaagcaatccagaaaagagtaccctgtgcttatgacaagactgccttggcattagaggtt
ggtgacattgtgaaagtcacaaggatgaatataaatggccagtgggaaggcgaggtgaat
gggcgcaaaggtcttttcccctttacgcacgtcaaaatctttgaccctcaaaacccagat
gaaaacgagtga

DBGET integrated database retrieval system