KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029401
Entry
101029401         CDS       T04350                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00562  Inositol phosphate metabolism
sbq01100  Metabolic pathways
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04062  Chemokine signaling pathway
sbq04070  Phosphatidylinositol signaling system
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04270  Vascular smooth muscle contraction
sbq04310  Wnt signaling pathway
sbq04371  Apelin signaling pathway
sbq04540  Gap junction
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04621  NOD-like receptor signaling pathway
sbq04713  Circadian entrainment
sbq04720  Long-term potentiation
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04728  Dopaminergic synapse
sbq04730  Long-term depression
sbq04742  Taste transduction
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04911  Insulin secretion
sbq04912  GnRH signaling pathway
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04922  Glucagon signaling pathway
sbq04924  Renin secretion
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04929  GnRH secretion
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04961  Endocrine and other factor-regulated calcium reabsorption
sbq04970  Salivary secretion
sbq04971  Gastric acid secretion
sbq04972  Pancreatic secretion
sbq04973  Carbohydrate digestion and absorption
sbq05010  Alzheimer disease
sbq05016  Huntington disease
sbq05017  Spinocerebellar ataxia
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05142  Chagas disease
sbq05143  African trypanosomiasis
sbq05146  Amoebiasis
sbq05163  Human cytomegalovirus infection
sbq05200  Pathways in cancer
Module
sbq_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101029401 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101029401 (PLCB3)
   04310 Wnt signaling pathway
    101029401 (PLCB3)
   04371 Apelin signaling pathway
    101029401 (PLCB3)
   04020 Calcium signaling pathway
    101029401 (PLCB3)
   04070 Phosphatidylinositol signaling system
    101029401 (PLCB3)
   04072 Phospholipase D signaling pathway
    101029401 (PLCB3)
   04071 Sphingolipid signaling pathway
    101029401 (PLCB3)
   04022 cGMP-PKG signaling pathway
    101029401 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101029401 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101029401 (PLCB3)
   04613  Neutrophil extracellular trap formation
    101029401 (PLCB3)
   04621 NOD-like receptor signaling pathway
    101029401 (PLCB3)
   04062 Chemokine signaling pathway
    101029401 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    101029401 (PLCB3)
   04922 Glucagon signaling pathway
    101029401 (PLCB3)
   04929 GnRH secretion
    101029401 (PLCB3)
   04912 GnRH signaling pathway
    101029401 (PLCB3)
   04915 Estrogen signaling pathway
    101029401 (PLCB3)
   04921 Oxytocin signaling pathway
    101029401 (PLCB3)
   04926 Relaxin signaling pathway
    101029401 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    101029401 (PLCB3)
   04918 Thyroid hormone synthesis
    101029401 (PLCB3)
   04919 Thyroid hormone signaling pathway
    101029401 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    101029401 (PLCB3)
   04916 Melanogenesis
    101029401 (PLCB3)
   04924 Renin secretion
    101029401 (PLCB3)
   04925 Aldosterone synthesis and secretion
    101029401 (PLCB3)
   04927 Cortisol synthesis and secretion
    101029401 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101029401 (PLCB3)
   04270 Vascular smooth muscle contraction
    101029401 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    101029401 (PLCB3)
   04971 Gastric acid secretion
    101029401 (PLCB3)
   04972 Pancreatic secretion
    101029401 (PLCB3)
   04973 Carbohydrate digestion and absorption
    101029401 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101029401 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101029401 (PLCB3)
   04725 Cholinergic synapse
    101029401 (PLCB3)
   04728 Dopaminergic synapse
    101029401 (PLCB3)
   04726 Serotonergic synapse
    101029401 (PLCB3)
   04720 Long-term potentiation
    101029401 (PLCB3)
   04730 Long-term depression
    101029401 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    101029401 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    101029401 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    101029401 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101029401 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101029401 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101029401 (PLCB3)
   05016 Huntington disease
    101029401 (PLCB3)
   05017 Spinocerebellar ataxia
    101029401 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    101029401 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101029401 (PLCB3)
   04934 Cushing syndrome
    101029401 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101029401 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101029401 (PLCB3)
   05142 Chagas disease
    101029401 (PLCB3)
   05143 African trypanosomiasis
    101029401 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101029401 (PLCB3)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101029401 (PLCB3)
Membrane trafficking [BR:sbq04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101029401 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101029401 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y PH_14 EF-hand_like C2 DUF1154 BPL_N
Other DBs
NCBI-GeneID: 101029401
NCBI-ProteinID: XP_010346545
UniProt: A0A2K6V229
LinkDB
Position
Unknown
AA seq 1175 aa
MEVDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFL
NFMAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKM
FSADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGK
PYLTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNKQFLERDQMSMEGFSR
YLGGEENGILPLEALDLSADMTQPLSSYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGC
RCVELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDS
AKQQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHQPSTGGP
DSAGRKRPLEQSNSALSESSATTEPSSPQLGSPSSDSCPGLSNGEEGVLEKPSLELQKSL
GEEGLNRGPYALGPADREEEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIE
PVKFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSN
YMPQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEV
IVDGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDE
EPFAFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPAL
LIYTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGHETCQDTQSQ
QLGSQLSPNPSPSPLDASPRRPPGPATSPTSASLSSPGQRDDLIASILSEVAPTPLDELR
GHKALVKLRSRQERELRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRPRPGALGGAAEE
DSKEGEDEAKRYQEFQSRQVQSLLGLREAQADAEARRRLEHLKQAQQRLREVVLDANTTQ
FKRLKETNEREKKELQKILDRKRHNSISEAKTRDKHKKEVELTEINRRHITESVNSIRRL
EEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEHRARLPQEIRRSLLGETPEGL
GDRPLVACASNGHAPGSSGHLSGADSESQEENTQL
NT seq 3528 nt   +upstreamnt  +downstreamnt
atggaggtggacacactggacatcagttccatcagggacacacggacgggccggtacgcc
cgcctgcccaaggatcccaagatccgggaagttctgggctttgggggtcccgacgcccgg
ctggaggagaagctgatgacggtggtgtctgggccggaccccgtgaacacagtgttcttg
aacttcatggccgtgcaggacgatacagccaaggtctggtccgaggagctgttcaagctg
gctatgaacatcctggctcagaacgcctcccggaacaccttcctgcgcaaagcatacacg
aagctgaagctgcaggtgaaccaggatggtcggatccccgtcaagaacatcctgaagatg
ttctcagccgacaagaagcgagtagagactgcgctggaatcctgtggcctcaacttcaac
cggagtgagtccatccgacccgatgagttttccttggaaatctttgagcggtttctgaac
aagctgtgtctgcggccggacattgacaagatcctgctggagataggtgccaagggcaag
ccatacctgacgctggagcagctcatggacttcatcaaccagaagcaacgtgacccgaga
ctcaacgaagtgctgtacccacccctgcggccctcccaagcccggctgctcattgagaag
tatgagcccaacaagcagtttctggagcgagaccagatgtccatggagggctttagccga
tacctgggaggcgaggagaatggtatcctgcccctggaagctctggatctgagtgcagac
atgacccagccgctgagctcctacttcatcaactcctcgcataacacctatctcactgcg
gggcagctggctgggacctcgtcagtggagatgtaccgccaggccctgctctggggctgc
cgctgcgtggagctggacgtgtggaaggggcggccgcccgaggaggagcccttcatcacc
catggcttcaccatgaccacggaggtgcctctgcgagacgtgctggaggccattgctgag
actgccttcaagacctctccctaccccgtcatcctctcctttgagaaccacgtggattcg
gcaaagcagcaggcaaagatggccgagtactgccgctccatctttggagatgcgctgctt
atcgaccctctggacaagtacccgctggccccaggcgtccctctgcccagcccccaggac
ctgatgggccgaatcctggtgaagaacaagaagcggcaccagccgagcaccggcggccca
gacagtgccgggcgcaagcggccactggagcagagcaactcggccctgagcgagagctcc
gccaccaccgagccctcctccccgcagcttgggtctcccagctctgacagctgcccaggc
ctgagcaatggggaggagggggtgctcgagaagcccagcctggagcttcaaaaatctttg
ggcgaggagggcctgaaccggggcccctatgctcttggacctgctgaccgtgaggaggag
gaggaagatgaggaagaagaggaacagacagaccccaaaaagccaaccacagatgagggc
acagctagcagcgaggtcaatgccactgaggagatgtccacgcttgtcaactacatcgag
cctgtcaagttcaagtcctttgaggctgctcgaaagaggaacaaatgcttcgagatgtca
tccttcgtggagaccaaggccatggagcagctgaccaagagccccatggagtttgtggaa
tacaacaagcagcagctcagccgcatctaccccaagggcacccgcgtggactcctccaac
tacatgccccagctcttctggaacgtagggtgccagcttgtcgcgctcaacttccagacc
ctggatgtggcgatgcagctcaatgcgggcgtgttcgagtacaatgggcgcagcgggtac
ctgctcaagccggagttcatgcggcggccggacaagtccttcgaccccttcaccgaagtc
atcgtcgatggcatcgtggccaatgccttgcgggtcaaggtgatctcggggcagttcctg
tccgacaggaaggtgggcatctacgtggaggtggacatgtttggcctccccgttgacacg
cggcgcaagtaccgcacccggacctctcaggggaactccttcaaccccgtgtgggacgag
gagccgttcgccttccccaaggtggtgctgcccacgctggcttcgcttcgcatcgcagcc
tttgaggagggcggcaaattcgtggggcaccggatcctgcctgtctctgccatccgctcc
gggtaccactacgtctgcctgcggaacgaggccaaccaaccgctgtgcctgccggccctg
ctcatctacaccgaggcctcggactacattccggacgaccaccaggactacgcggaggcc
ttgatcaaccccattaagcacgtcagcctgatggaccagagagcccgccaactggctgcc
ctcattggtgagagtgaggctcaggctggccacgagacatgccaggacacccagtctcag
cagctggggtctcagctgtccccaaaccccagtcctagcccactggatgcttccccacgc
cggccccccggccctgccacctcccctaccagcgcctctctgagcagcccagggcagcgc
gacgatctcatcgccagcatcctctcagaggtggcccccaccccgctggacgagctccga
ggacacaaggctctggtcaagctccggagccggcaggagcgagagcttcgggagctgcgc
aagaagcatcagcggaaggcggtcaccctcacccgccgcctgctggatggcctggctcag
gcacaggcggagggcaggtgccggccgcggccaggtgccctaggtggggctgctgaagag
gactcaaaggagggggaggacgaggcgaagcgctatcaggagttccagagcagacaggtg
cagagcctactggggctgcgggaggcccaggcggacgcagaggcgcggcggaggctggag
cacctgaaacaggctcagcagcggctcagggaggtcgtccttgatgcaaacacgactcag
ttcaagaggctgaaggagacgaacgagagggagaagaaggagctgcagaagatcctggac
agaaagcgccacaacagcatctcggaggccaagacaagggacaagcataagaaggaggtg
gaactgacagagattaatcgtcggcacatcactgagtctgtcaactccatccgtcggctg
gaggaggcccagaagcagcggcacgaccgtcttgtggcgggccagcagcaggttctgcaa
cagctggcagaagaggagcccaagctgctggctcagctggcccaggagtgtcaggagcat
cgggcaaggctgccccaggagatccgccggagcctgctgggcgagacgccagaggggctg
ggggacaggcctctggtggcctgtgccagcaacggtcacgcacccgggagcagcgggcac
ctgtcgggtgctgactcggagagccaggaggagaacacgcagctctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046851
Entry
101046851         CDS       T04350                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00562  Inositol phosphate metabolism
sbq01100  Metabolic pathways
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04062  Chemokine signaling pathway
sbq04070  Phosphatidylinositol signaling system
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04270  Vascular smooth muscle contraction
sbq04310  Wnt signaling pathway
sbq04371  Apelin signaling pathway
sbq04540  Gap junction
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04621  NOD-like receptor signaling pathway
sbq04713  Circadian entrainment
sbq04720  Long-term potentiation
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04728  Dopaminergic synapse
sbq04730  Long-term depression
sbq04742  Taste transduction
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04911  Insulin secretion
sbq04912  GnRH signaling pathway
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04922  Glucagon signaling pathway
sbq04924  Renin secretion
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04929  GnRH secretion
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04961  Endocrine and other factor-regulated calcium reabsorption
sbq04970  Salivary secretion
sbq04971  Gastric acid secretion
sbq04972  Pancreatic secretion
sbq04973  Carbohydrate digestion and absorption
sbq05010  Alzheimer disease
sbq05016  Huntington disease
sbq05017  Spinocerebellar ataxia
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05142  Chagas disease
sbq05143  African trypanosomiasis
sbq05146  Amoebiasis
sbq05163  Human cytomegalovirus infection
sbq05200  Pathways in cancer
Module
sbq_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101046851 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101046851 (PLCB4)
   04310 Wnt signaling pathway
    101046851 (PLCB4)
   04371 Apelin signaling pathway
    101046851 (PLCB4)
   04020 Calcium signaling pathway
    101046851 (PLCB4)
   04070 Phosphatidylinositol signaling system
    101046851 (PLCB4)
   04072 Phospholipase D signaling pathway
    101046851 (PLCB4)
   04071 Sphingolipid signaling pathway
    101046851 (PLCB4)
   04022 cGMP-PKG signaling pathway
    101046851 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101046851 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101046851 (PLCB4)
   04613  Neutrophil extracellular trap formation
    101046851 (PLCB4)
   04621 NOD-like receptor signaling pathway
    101046851 (PLCB4)
   04062 Chemokine signaling pathway
    101046851 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    101046851 (PLCB4)
   04922 Glucagon signaling pathway
    101046851 (PLCB4)
   04929 GnRH secretion
    101046851 (PLCB4)
   04912 GnRH signaling pathway
    101046851 (PLCB4)
   04915 Estrogen signaling pathway
    101046851 (PLCB4)
   04921 Oxytocin signaling pathway
    101046851 (PLCB4)
   04926 Relaxin signaling pathway
    101046851 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    101046851 (PLCB4)
   04918 Thyroid hormone synthesis
    101046851 (PLCB4)
   04919 Thyroid hormone signaling pathway
    101046851 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    101046851 (PLCB4)
   04916 Melanogenesis
    101046851 (PLCB4)
   04924 Renin secretion
    101046851 (PLCB4)
   04925 Aldosterone synthesis and secretion
    101046851 (PLCB4)
   04927 Cortisol synthesis and secretion
    101046851 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101046851 (PLCB4)
   04270 Vascular smooth muscle contraction
    101046851 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    101046851 (PLCB4)
   04971 Gastric acid secretion
    101046851 (PLCB4)
   04972 Pancreatic secretion
    101046851 (PLCB4)
   04973 Carbohydrate digestion and absorption
    101046851 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101046851 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    101046851 (PLCB4)
   04725 Cholinergic synapse
    101046851 (PLCB4)
   04728 Dopaminergic synapse
    101046851 (PLCB4)
   04726 Serotonergic synapse
    101046851 (PLCB4)
   04720 Long-term potentiation
    101046851 (PLCB4)
   04730 Long-term depression
    101046851 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    101046851 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    101046851 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    101046851 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101046851 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101046851 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101046851 (PLCB4)
   05016 Huntington disease
    101046851 (PLCB4)
   05017 Spinocerebellar ataxia
    101046851 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    101046851 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101046851 (PLCB4)
   04934 Cushing syndrome
    101046851 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101046851 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101046851 (PLCB4)
   05142 Chagas disease
    101046851 (PLCB4)
   05143 African trypanosomiasis
    101046851 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101046851 (PLCB4)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101046851 (PLCB4)
Membrane trafficking [BR:sbq04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101046851 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101046851 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_6 EF-hand_7
Other DBs
NCBI-GeneID: 101046851
NCBI-ProteinID: XP_003933259
UniProt: A0A2K6U2J0
LinkDB
Position
Unknown
AA seq 1187 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPTAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALRSM
MEAGEAASPANILEDDNEEEIESADQEEEAHPEFKFGNELSADDLGHKEAVANSVKKASD
DLEHENNKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFNVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQ
SSSELRPTTTAALASGVEAKKGIELIPQIRIEDLKQMKAYLKHLKKQQKELNSLKKKHAK
EHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSD
HKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLS
HDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMK
QSKEMDQLKKVQLEHLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV
NT seq 3564 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcagaaggaagttccttcctttttgcaagaagga
gcagtttttgacagatatgaagaggaatcctttgtgtttgaacccaactgcctcttcaaa
gtggatgagtttggcttctttctgacctggaaaagtgaaggcaaggaaggacaggtgcta
gaatgctccctcatcaacagtattcggtcgggagccataccaaaggatcccaaaatcttg
gctgctcttgaagctgttggaaaatcagaaaatgatctggaagggcggatagtttgtgtc
tgcagtggcacagatctagtgaacattagctttacctacatggtggctgaaaatccagaa
gtaactaagcaatgggtagaaggcctgagatcaatcatacacaacttcagggccaacaac
gtcagtccaatgacgtgcctcaaaaaacactggatgaaattggcatttatgaccaacaca
aatggtaaaattccggttagaagtattactagaacctttgcatcgggaaaaacagaaaaa
gtcatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgag
cccacggcatttacttatgaaaagttctatgaactgacacagaagatttgtcctcggaca
gatatagaagatcttttcaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacaccaacgagatcctcgactgaatgaaattttattt
ccattttatgatgccaaaagggcaatgcagatcattgagatgtatgagcctgatgaagat
ttgaagaaaaaaggccttatatcaagtgatgggttttgcagatatctgatgtccgatgaa
aatgccccagtcttcctagatcgtttagaactttaccaagaaatggaccaccctctggct
cactacttcatcagttcttcccataacacttatctcactggcagacagttcggcgggaag
tcttcagtagaaatgtacagacaggttctcctggctggttgcagatgtgttgaacttgac
tgctgggatggaaaaggtgaagaccaagaaccaataataactcatggaaaagcaatgtgt
acagatatcctttttaaggatgtaattcaagccatcaaggaaactgcatttgtcacatca
gaatatcctgtaattctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctatttggggatctcctgctgaaacaagcacttgaatcacat
ccactcgaaccaggcaggcctttgccatcccccaatgacctcaaaagaaaaatactcata
aaaaacaagcggctgaaacctgaggttgaaaaaaaacagctggaagctttgagaagcatg
atggaagctggagaagctgcctccccagcaaacatcttagaggatgataatgaagaggag
atcgaaagtgctgaccaagaagaggaagctcaccccgaattcaaatttggaaatgaactt
tctgctgatgacttgggtcacaaggaagctgttgcaaacagcgtcaagaaggcctcagat
gaccttgaacatgaaaacaacaaaaagggcctggtcactgtagaagatgagcaggcgtgg
atggcatcttataaatatgtaggtgctaccactaatatccatccatatttgtccacaatg
atcaactacgcccagcctgtaaagtttcaaggtttcaatgtggcagaagaacgcaatatt
cattacaacatgtcttcttttaatgaatcagtcggtcttggctacttgaagacacacgca
attgaatttgtcaattataacaaacggcaaatgagtcgcatttaccccaagggaggccga
gtagattccagtaattacatgcctcagattttctggaacgctggctgccagatggtttca
ctgaactatcaaaccccagatttagcgatgcaattgaatcagggaaaatttgagtataat
ggatcatgcgggtaccttctcaaaccagatttcatgaggcggcctgatcgaacatttgat
cctttctctgaaactcctgttgatggcgttattgcagccacttgttcagtgcaggttata
tcaggtcaattcttatcagataagaaaattggcacctacgtagaagtggatatgtatggg
ttgcccactgacaccatacgtaaggaattccgaactcgcatggttatgaataatggactc
aatccagtttacaatgaagagtcatttgtatttcgtaaggtgattctgccggacctggct
gtcttgagaatagcagtgtatgatgataacaacaagctgattggccagaggatcctcccg
cttgatggcctccaagcaggatatcgacacatttcccttcgaaatgagggaaataaacct
ttatcactgccaacaattttctgcaatattgttcttaaaacatatgtgcctgatggattt
ggagatattgtggatgctttatcagatccaaagaaatttctctcaattacggaaaagaga
gcagaccaaatgagagctatgggcattgaaacaagtgacatagctgatgtgcccagtgac
acttccaaaaatgacaagaaaggaaaggccaacaccgccaaagcaaatgtgacccctcag
agtagctccgagctcagaccaaccaccacagctgccctggcctctggtgtggaagccaag
aaaggtattgaacttatccctcaaataaggatagaagatttaaagcagatgaaggcttac
ttgaagcatttaaagaaacagcagaaggagctaaattctttaaagaagaaacatgcaaag
gagcacagtaccatgcagaagttacactgcacacaagttgacaaaattgtggcacagtat
gacaaagagaagtcaactcacgagaaaatcctagagaaggcaatgaagaagaagggggga
agtaattgtctcgaaatgaaaaaagaaacagaaattaaaattcagacactgacatcagat
cacaaatctaaggtcaaagagattgtagcacagcacacaaaggaatggtcagaaatgatc
aatacccacagtgctgaggagcaagaaatccgagacctgcacctcagccagcagtgcgag
ctgctgaagaagctactcatcaacgcccacgagcagcagacccagcagctgaaactgtcc
catgacagggaaagcaaggaaatgcgagcacaccaggctaagatttctatggaaaatagc
aaagccatcagccaagataaatctatcaagaataaagcagaacgggaaaggcgagtcagg
gagttaaacagcagcaacactaaaaagtttctggaagaaagaaagagactcgcaatgaag
cagtccaaagagatggatcagttgaaaaaagtccagcttgaacatctagaattcctagag
aaacagaatgagcaggcgaaggagatgcagcagatggtgaaattggaagccgagatggac
cgcagaccagcaacagtagtatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047168
Entry
101047168         CDS       T04350                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 isoform X2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00562  Inositol phosphate metabolism
sbq01100  Metabolic pathways
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04062  Chemokine signaling pathway
sbq04070  Phosphatidylinositol signaling system
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04270  Vascular smooth muscle contraction
sbq04310  Wnt signaling pathway
sbq04371  Apelin signaling pathway
sbq04540  Gap junction
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04621  NOD-like receptor signaling pathway
sbq04713  Circadian entrainment
sbq04720  Long-term potentiation
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04728  Dopaminergic synapse
sbq04730  Long-term depression
sbq04742  Taste transduction
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04911  Insulin secretion
sbq04912  GnRH signaling pathway
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04922  Glucagon signaling pathway
sbq04924  Renin secretion
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04929  GnRH secretion
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04961  Endocrine and other factor-regulated calcium reabsorption
sbq04970  Salivary secretion
sbq04971  Gastric acid secretion
sbq04972  Pancreatic secretion
sbq04973  Carbohydrate digestion and absorption
sbq05010  Alzheimer disease
sbq05016  Huntington disease
sbq05017  Spinocerebellar ataxia
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05142  Chagas disease
sbq05143  African trypanosomiasis
sbq05146  Amoebiasis
sbq05163  Human cytomegalovirus infection
sbq05200  Pathways in cancer
Module
sbq_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101047168 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101047168 (PLCB1)
   04310 Wnt signaling pathway
    101047168 (PLCB1)
   04371 Apelin signaling pathway
    101047168 (PLCB1)
   04020 Calcium signaling pathway
    101047168 (PLCB1)
   04070 Phosphatidylinositol signaling system
    101047168 (PLCB1)
   04072 Phospholipase D signaling pathway
    101047168 (PLCB1)
   04071 Sphingolipid signaling pathway
    101047168 (PLCB1)
   04022 cGMP-PKG signaling pathway
    101047168 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101047168 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101047168 (PLCB1)
   04613  Neutrophil extracellular trap formation
    101047168 (PLCB1)
   04621 NOD-like receptor signaling pathway
    101047168 (PLCB1)
   04062 Chemokine signaling pathway
    101047168 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    101047168 (PLCB1)
   04922 Glucagon signaling pathway
    101047168 (PLCB1)
   04929 GnRH secretion
    101047168 (PLCB1)
   04912 GnRH signaling pathway
    101047168 (PLCB1)
   04915 Estrogen signaling pathway
    101047168 (PLCB1)
   04921 Oxytocin signaling pathway
    101047168 (PLCB1)
   04926 Relaxin signaling pathway
    101047168 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    101047168 (PLCB1)
   04918 Thyroid hormone synthesis
    101047168 (PLCB1)
   04919 Thyroid hormone signaling pathway
    101047168 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    101047168 (PLCB1)
   04916 Melanogenesis
    101047168 (PLCB1)
   04924 Renin secretion
    101047168 (PLCB1)
   04925 Aldosterone synthesis and secretion
    101047168 (PLCB1)
   04927 Cortisol synthesis and secretion
    101047168 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101047168 (PLCB1)
   04270 Vascular smooth muscle contraction
    101047168 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    101047168 (PLCB1)
   04971 Gastric acid secretion
    101047168 (PLCB1)
   04972 Pancreatic secretion
    101047168 (PLCB1)
   04973 Carbohydrate digestion and absorption
    101047168 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101047168 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101047168 (PLCB1)
   04725 Cholinergic synapse
    101047168 (PLCB1)
   04728 Dopaminergic synapse
    101047168 (PLCB1)
   04726 Serotonergic synapse
    101047168 (PLCB1)
   04720 Long-term potentiation
    101047168 (PLCB1)
   04730 Long-term depression
    101047168 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    101047168 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    101047168 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    101047168 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101047168 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101047168 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101047168 (PLCB1)
   05016 Huntington disease
    101047168 (PLCB1)
   05017 Spinocerebellar ataxia
    101047168 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    101047168 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101047168 (PLCB1)
   04934 Cushing syndrome
    101047168 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101047168 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101047168 (PLCB1)
   05142 Chagas disease
    101047168 (PLCB1)
   05143 African trypanosomiasis
    101047168 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101047168 (PLCB1)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101047168 (PLCB1)
Membrane trafficking [BR:sbq04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101047168 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101047168 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 101047168
NCBI-ProteinID: XP_003933260
UniProt: A0A2K6T749
LinkDB
Position
Unknown
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTSLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPPSLSSDPGKVNHKTPSS
EELGGDIPGKEFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggccggggctcaacccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgattcaactattgttactcca
attattttgaggactgaccctcagggatttttcttttattggacagatcaaaataaggag
acggagctactggatctcagccttgtcaaagatgccagatgtgggagacacgccaaagct
cccaaggaccccaaattacgtgaacttttggacgtggggaacatcggacgcctggagcag
cgcatgatcacagtggtgtatgggcctgacctcgtcaacatctcccatttgaatctcgtg
gctttccaagaagaagtagccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccagggatgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgtattcctctcaaaaacatatatcgcttgttttcagca
gaccggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctgaacaacctttgc
cctcgacctgaaattgataacatcttttcagaatttggtgccaaaagcaaaccatacctt
acggttgatcagatgatggattttatcaaccttaagcagcgagatcctcggcttaatgaa
atactttatccacctctaaaacaagagcaagtccaagtattgattgagaaatatgaaccc
aacaacagcctcgccaaaaaaggacagatatcagtggatgggttcatgcgctatctgagt
ggagaagaaaacggagtcgtttcacctgagaaactggatttgaacgaagacatgtctcag
cccctttctcactatttcattaattcctcgcacaacacctacctcacagctggccaactg
gctggaaactcctctgttgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtg
gagctggactgctggaagggacggactgcagaagaggaacctgtcatcacccatggcttc
accatgacaactgaaatatctttcaaggaagtgatagaggcaattgcggagtgcgcgttc
aagacttcaccttttccaattctcctttcatttgagaaccatgtggattccccaaagcag
caagccaagatggcggaatattgccgactgatctttggggatgcccttctcatggagccc
ctggaaaaatatccgctcgaatctggagttcctcttccaagtcctatggatttaatgtat
aaaattttggtgaaaaataagaagaaatcacacaagtcatcagaaggaagtggcaaaaag
aagctctcagaacaagcctccaacacctacagtgactcctccagtgtgttcgagccctca
tccccaggagccggagaagctgatacggaaagtgacgatgatgatgatgacgatgactgt
aaaaaatcttcaatggatgaggggactgctggaagcgaggctatggccacagaagaaatg
tctaacctggtgaactacattcagccggtcaagtttgagtcatttgaaatttcaaaaaaa
agaaataaaagtttcgaaatgtcttccttcgtggaaaccaaaggacttgaacaacttacc
aagtctcccgtggaatttgtagaatataacaaaatgcagcttagcaggatatatccgaaa
ggaacacgtgtggattcatccaactatatgcctcagctcttctggaatgcaggttgtcag
atggtggcacttaatttccagacaatggacctggctatgcaaataaatatgggcatgtat
gaatacaacgggaagagtggctacagattgaagccagaattcatgaggaggcctgacaag
cattttgatccatttactgaaggcatcgtagatgggatagtagcaaacactttatctgtt
aagattatttcaggtcagtttctttctgataagaaagttgggacttacgtggaagtggat
atgtttggtttgcctgtggatacaaggaggaaggcatttaagacaaagacatcccaagga
aatgctgtgaatcccgtctgggaagaagaacctattgtgttcaaaaaggtggttcttcct
actctggcctgtttgagaatagcagtttatgaagaaggaggtaaatttattggccaccgt
atcttgccagtgcaagccattcgaccaggctatcactatatctgcctaaggaatgaaagg
aaccagcctctgacgctgcctgctgtctttgtctacatagaagtgaaagactatgtgcca
gacacatatgcagatgtcattgaagctttatcaaacccaatccgatatgtgaacctgatg
gagcagagagcgaagcagttggctgctttgacactagaagatgaagaagaagtaaagaaa
gaggctgatcctggagaaacaccatcagaggctccaagtgaagcaaggacgactccagca
gaaaatggggtgaatcacactacatccctgacacccaagccaccctcccaggctctccac
agccagccagctccaggttctgtaaaagcacctgccaaaacagaagatcttattcaaagt
gtcttaacagaagtggaagcacagaccatcgaagagctaaagcaacagaaatcgtttgtg
aaacttcaaaagaagcactacaaagaaatgaaagacctggttaagaggcaccacaagaaa
accactgaccttatcaaagaacacactacaaagtataatgagattcagaatgactacctg
agaaggagagcagctttggaaaagtctgccaaaaaggacagtaagaaaaaatcagaaccc
agcagccctgatcatggttcgtcaacaattgagcaagacctcgctgccctggatgctgaa
atgacccaaaagttaattgacttaaaggacaaacaacagcagcagctgcttaatcttcgg
caagaacagtattatagtgaaaaataccagaagcgagaacatattaaactgcttattcaa
aaattgacagatgtcgcagaagagtgtcagaacaatcagttaaagaagctcaaagaaatc
tgtgagaaagaaaagaaggaattaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaaatccaaagacaaaagtcagatggaagaggagaagacagagatgattcgg
tcatacatccaggaagtggtgcagtacatcaagaggttagaagaggcccaaagtaaacgg
caggaaaaacttgtagagaaacacaaggagatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggagctggagcaagaataccaagacaaattcaaaagactgccccttgaa
attttggaattcgtgcaggaagccatgaaagggaagatcagtgaagacagcaatcatggt
tctgcccctccctccctgtcctcagaccctggaaaagtgaaccacaagactccctccagt
gaggagctgggaggagacatcccaggaaaagaatttgatactcctctgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052271
Entry
101052271         CDS       T04350                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00562  Inositol phosphate metabolism
sbq01100  Metabolic pathways
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04062  Chemokine signaling pathway
sbq04070  Phosphatidylinositol signaling system
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04270  Vascular smooth muscle contraction
sbq04310  Wnt signaling pathway
sbq04371  Apelin signaling pathway
sbq04540  Gap junction
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04621  NOD-like receptor signaling pathway
sbq04713  Circadian entrainment
sbq04720  Long-term potentiation
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04728  Dopaminergic synapse
sbq04730  Long-term depression
sbq04742  Taste transduction
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04911  Insulin secretion
sbq04912  GnRH signaling pathway
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04922  Glucagon signaling pathway
sbq04924  Renin secretion
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04929  GnRH secretion
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04961  Endocrine and other factor-regulated calcium reabsorption
sbq04970  Salivary secretion
sbq04971  Gastric acid secretion
sbq04972  Pancreatic secretion
sbq04973  Carbohydrate digestion and absorption
sbq05010  Alzheimer disease
sbq05016  Huntington disease
sbq05017  Spinocerebellar ataxia
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05142  Chagas disease
sbq05143  African trypanosomiasis
sbq05146  Amoebiasis
sbq05163  Human cytomegalovirus infection
sbq05200  Pathways in cancer
Module
sbq_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101052271 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101052271 (PLCB2)
   04310 Wnt signaling pathway
    101052271 (PLCB2)
   04371 Apelin signaling pathway
    101052271 (PLCB2)
   04020 Calcium signaling pathway
    101052271 (PLCB2)
   04070 Phosphatidylinositol signaling system
    101052271 (PLCB2)
   04072 Phospholipase D signaling pathway
    101052271 (PLCB2)
   04071 Sphingolipid signaling pathway
    101052271 (PLCB2)
   04022 cGMP-PKG signaling pathway
    101052271 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101052271 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101052271 (PLCB2)
   04613  Neutrophil extracellular trap formation
    101052271 (PLCB2)
   04621 NOD-like receptor signaling pathway
    101052271 (PLCB2)
   04062 Chemokine signaling pathway
    101052271 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    101052271 (PLCB2)
   04922 Glucagon signaling pathway
    101052271 (PLCB2)
   04929 GnRH secretion
    101052271 (PLCB2)
   04912 GnRH signaling pathway
    101052271 (PLCB2)
   04915 Estrogen signaling pathway
    101052271 (PLCB2)
   04921 Oxytocin signaling pathway
    101052271 (PLCB2)
   04926 Relaxin signaling pathway
    101052271 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    101052271 (PLCB2)
   04918 Thyroid hormone synthesis
    101052271 (PLCB2)
   04919 Thyroid hormone signaling pathway
    101052271 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    101052271 (PLCB2)
   04916 Melanogenesis
    101052271 (PLCB2)
   04924 Renin secretion
    101052271 (PLCB2)
   04925 Aldosterone synthesis and secretion
    101052271 (PLCB2)
   04927 Cortisol synthesis and secretion
    101052271 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101052271 (PLCB2)
   04270 Vascular smooth muscle contraction
    101052271 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    101052271 (PLCB2)
   04971 Gastric acid secretion
    101052271 (PLCB2)
   04972 Pancreatic secretion
    101052271 (PLCB2)
   04973 Carbohydrate digestion and absorption
    101052271 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101052271 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    101052271 (PLCB2)
   04725 Cholinergic synapse
    101052271 (PLCB2)
   04728 Dopaminergic synapse
    101052271 (PLCB2)
   04726 Serotonergic synapse
    101052271 (PLCB2)
   04720 Long-term potentiation
    101052271 (PLCB2)
   04730 Long-term depression
    101052271 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    101052271 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    101052271 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    101052271 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101052271 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101052271 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101052271 (PLCB2)
   05016 Huntington disease
    101052271 (PLCB2)
   05017 Spinocerebellar ataxia
    101052271 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    101052271 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101052271 (PLCB2)
   04934 Cushing syndrome
    101052271 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101052271 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101052271 (PLCB2)
   05142 Chagas disease
    101052271 (PLCB2)
   05143 African trypanosomiasis
    101052271 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101052271 (PLCB2)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101052271 (PLCB2)
Membrane trafficking [BR:sbq04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101052271 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101052271 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 MMACHC UvrD-helicase
Other DBs
NCBI-GeneID: 101052271
NCBI-ProteinID: XP_003935769
UniProt: A0A2K6UFL1
LinkDB
Position
Unknown
AA seq 1170 aa
MSLLNAVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNNFLLKALTVVSGPDMVDLTFHNFVSYKE
NVGKVWAEDVLALVKHPLTANAPRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPETVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINVQRGQLSPEGMVWFLCGPEN
SVLAHDKLLLHHDMAQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGIPLPSPEDLRGKILIKNKKNQFSGPTSSSKEPGGE
AEGSSPPNAPAGEGTVWAGEEGTELEEEEVEEEEEEESGSLDEEEMKKMQSDEGTAGLEV
TAYEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQM
SRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEF
MRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRT
KLSPSTNSINPVWKEAPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHL
CLRSESNMPLTMPALFIYLEMKDYVPGAWADLTVALANPIKFFSAHDKKSVKLEEAMGGL
PEKPFPLGSPVASQVNGALAPTSNGSAEPRPASLEELRELKGVVKLQRRHEKELQELERR
GTRRWGELLQRGAAQLAELGPPGAGGGGACKLGPGKGSHKKRSLPCGESTGAAPGKGPEG
MEARVRELKDRLELELLRLGEEQYECVLKRKEQQVAEQISKMMELAREKQVAELKALKET
SEIDTKEMKKKLETKRLEQIQAMTKTTTDKMAQERLKREINNSHIQEVVRVIKQMTESLE
RHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEAKESVRSCFRTHFPTKAK
DKPERACESPRELCEQDPLVAKADAQESRL
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgtctctgctgaatgctgtcctgctgccccccaaagtgaaggcctatctgagtcagggg
gagcgcttcatcaaatgggatgatgaaactacagttgcctctccagttatcctccgtgtg
gatcctaagggctactacttatactggacatatcaaagtaaggagatggagtttctggat
atcaccagcatccgggacacccgctttgggaagtttgccaagatgcccaagagccagaag
ctccgggacgtcttcaacatggactttcctgacaacaacttcctgctgaaggcactcacg
gtggtgtccggcccagacatggtggacctaaccttccacaacttcgtttcctacaaggag
aatgtgggcaaggtctgggctgaggacgtactagccttagtcaagcatccactaacagcc
aacgccccccgcagcaccttcctggacaagatcctcgtaaagctcaagatgcagctcaac
tctgaagggaagattcctgtgaagaactttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgctctcagtgcctgccacctccccaaaggcaagaatgatgccatcaatcct
gaggacttcccagaaactgtctacaagagtttcctcatgagcctgtgtcctcggccagaa
atagatgagatcttcacttcttaccatgctaaggctaaaccctacatgacaaaggagcac
ctgaccaaattcatcaaccagaaacagcgggactcccggcttaactccctgctattccca
ccagcacggcctgatcaggtgcagggtctcatcgacaagtatgagcccagcggcatcaat
gtgcagaggggccagctgtcacctgagggcatggtctggtttctctgtgggccagagaac
agtgtgctggcccacgacaagctgctgctccaccacgacatggcacaaccactcaatcat
tacttcatcaactcctcccacaacacctacctgacagccggccagttctcaggcctctcc
tcggcggagatgtaccgccaggtgctgctgtctggctgccgttgtgtggagctagactgc
tggaaggggaaaccccctgacgaggagcccattatcacccatggcttcaccatgaccaca
gacatattcttcaaggaagcaattgaggctattgcagaaagtgcctttaagacctccccc
tatcccatcatcctgtcatttgagaaccatgtggactcaccccgccagcaggctaagatg
gccgagtactgccggacgatctttggggacatgctgctcacagagcccctggaaaagttc
ccactgaaaccaggcatccccctgcccagccctgaggatctcaggggcaagatcctcatc
aagaacaagaagaaccagttttctggccctacctcctccagtaaggagcctggtggggag
gctgagggcagcagcccacccaatgcccctgcaggcgagggcacagtgtgggctggcgag
gaagggactgagctggaggaggaggaggtagaagaggaagaggaggaggagtcgggaagc
ctggatgaagaagagatgaagaagatgcagtcggatgagggtacagcaggcctggaggtg
acggcttatgaagagatgtccagcctagtcaattacattcagcccaccaagttcatctcc
tttgagttctctgcccaaaagaaccgaagttatgtcatctcgtccttcacagagctcaag
gcatatgacctgctgtccaaggcctcagtgcagtttgtggactacaacaagcgccagatg
agccgcatttaccccaagggaacccgcatggactcctccaactacatgccccagatgttc
tggaatgctggatgccagatggttgccctcaacttccagacgatggacttgcccatgcag
cagaacatggcagtgtttgagttcaacgggcagagtggctacctcctcaagcacgagttc
atgcgccggccggacaagcagttcaaccccttctcagtggaccgcatcgatgtggtggtg
gccaccaccctttccatcacggtaatctctgggcagttcctatcagaacgcagtgtgcgc
acctatgtggaagtggagctgtttggccttcctggggaccccaagaggcgctatcgaact
aagctgtcacccagtaccaactccatcaatcctgtctggaaggaggcgccctttgtcttt
gagaagatcttgatgcctgagctggcctctctcagggtagctgtgatggaggaaggcaac
aagtttctcggccaccgtatcatccccatcaatgccctaaattctgggtaccaccacctg
tgcctgcgtagcgagagcaacatgcccctgaccatgcctgcactcttcatctatctggag
atgaaggactacgtacctggtgcctgggcagatctcactgtggccctcgccaatcccatc
aagttcttcagtgcccatgacaagaagtccgtgaagctggaggaggccatgggaggtctg
cctgagaagcccttcccactggggagtccagttgccagccaggtcaatggggcgttggcc
ccaacgagcaacgggtcagcagagccgcggcccgccagcctggaggagctccgggagctg
aagggcgtcgtgaagctgcagcggcggcacgagaaggagctgcaggagttggaacggcgc
ggcacgcggcgctggggggagctgctgcagcggggcgcggcgcagctggcggagctgggg
ccgccgggcgcgggtggtggcggggcctgcaagctcggcccgggcaagggctctcacaag
aagaggagcctgccctgcggggagagcaccggagctgcgccgggcaagggccctgagggc
atggaggcgcgggtgcgggaactgaaggacaggctggagctggagctgctgcggctgggc
gaggagcagtacgagtgcgttctgaagcgcaaggagcagcaagtggccgagcaaatctcc
aaaatgatggagctggccagagagaaacaggtggcagagctgaaggccctgaaggagaca
tcggagatcgacaccaaagagatgaagaaaaagctggagaccaagagactggagcagatc
caggccatgaccaaaaccaccacagacaagatggcccaggagaggttgaagagagagatt
aacaactcccacatccaggaagtagtgcgggtgatcaagcagatgacggagagcttggag
aggcaccaggagaagctggaggagaagcaggcagcctgcctggaacagatacgggagatg
gaaaagcagttccagaaggaggcactggcagagtacgaggccaggatgaagggtctggag
gcagaggcgaaggagtcagtgaggtcctgcttcaggacccacttccccaccaaggccaaa
gacaagcctgagagggcctgcgagtcccccagagaactgtgtgagcaggacccacttgtg
gcaaaggcagatgcccaagagagccgcctctga

DBGET integrated database retrieval system