KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029425Help
Entry
101029425         CDS       T04350                                 

Gene name
GSTZ1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X2
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00350  Tyrosine metabolism
sbq01100  Metabolic pathways
Module
sbq_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101029425 (GSTZ1)
Enzymes [BR:sbq01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     101029425 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_5 Glutaredoxin Tht1
Motif
Other DBs
NCBI-GeneID: 101029425
NCBI-ProteinID: XP_003924640
LinkDB All DBs
Position
Unknown
AA seq 223 aa AA seqDB search
MQAGKPILYSYFRSSCSWRVRIALALKGIDFEMVPINLIKDGGQQFSKDFQALNPMKQVP
TLKIDGITIHQSLAIIEYLEETRPTPRLLPQDPKKRASVRMISDLIASGIQPLQNLSILK
KVGEVSKDLREETHLTWAQNVITSGFNALEQILQSTAGKYCVGDEVTMADLCLVPQVVNA
ERFKVDFTPYPTISRINKRLLALEAFQVSHPCRQPDTPTELRA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctgggaagcccatcctctattcctatttccgaagctcctgctcatggagagtg
cgaattgctctggccttgaaaggcattgactttgagatggtgcccatcaatctcataaag
gatgggggccaacagttctctaaggacttccaggcactgaatcctatgaagcaggtgcca
accttgaagattgatggaatcaccattcatcagtcactggccatcattgagtacctagag
gagacgcgtcccactccacgacttctgcctcaggacccaaagaagagggccagcgtgcga
atgatttctgacctcatcgctagtggcatccagcccctgcagaacctgtctatcctgaag
aaagtgggagaggtttccaaggacttgagagaggagactcatctgacctgggcccagaat
gtcatcacgtctggctttaacgccctggagcagatcctgcagagcacagcaggcaaatac
tgtgtaggagatgaggtgaccatggctgatctgtgcttggtgcctcaggtggtaaatgcc
gagagattcaaggtggatttcacaccctaccccaccatcagccgtatcaacaagaggctg
ctggccttggaggccttccaggtgtctcacccctgccggcagccagatactcccactgag
ctgagggcctag

DBGET integrated database retrieval system