KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029483
Entry
101029483         CDS       T04350                                 

Gene name
JAG2
Definition
(RefSeq) protein jagged-2 isoform X1
  KO
K21635  jagged-2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04330  Notch signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq05200  Pathways in cancer
sbq05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101029483 (JAG2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101029483 (JAG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101029483 (JAG2)
  09162 Cancer: specific types
   05224 Breast cancer
    101029483 (JAG2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101029483 (JAG2)
SSDB
Motif
Pfam: EGF hEGF DSL EGF_2 EGF_CA
Other DBs
NCBI-GeneID: 101029483
NCBI-ProteinID: XP_010342200
LinkDB
Position
Unknown
AA seq 1119 aa
MPAHWGPGELSNLRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGH
VAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGRECKEAVCK
QGCNLLHGGCSVPGECRCNYGWQGRFCDECVPYPGCVHGSCVEPWQCSCETNWGGLLCDK
DLNYCGNHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGGSCHEVP
SGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANE
CEGKPCLNAFSCKNLIGGYYCDCIPGWKGTNCHININDCRGQCQHGGTCKDLVNGYQCVC
PRGFGGRHCELKRDECASSPCRSGGLCEDLADGFRCHCPQGFSGPLCEVDVDLCEPSPCR
NGARCYNLEGDYYCACPDDFAGKNCSVPREPCPGGACRVIDGCGLDAGPGAPRAAASGVC
GPHGRCVSQPGGNFSCVCDSGFTGTYCHENIDDCLGQPCRNGGTCIDGVDAFRCFCPSGW
EGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYTCSNGGT
CYDSGDTFRCACPPGWTGGTCTVAKNSSCLPNPCVNGGTCVGSGASFSCICRDGWEGRTC
THNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEI
NGYRCSCPPGRAGLRCQEVIGFGRSCWSRGTPFPHGSSWVEDCNSCRCLDGHRDCSKVWC
GWKPCLLSGQPEALSAQCPLGQRCLEKAPGQCLRPPCEAWGECGTEEPPSTPCLPRSGHL
DNNCARLTLRFSRDHVPQGTTVGAICSGIRSLPATRAVARDRLLVLVCDRASSEASAVEV
AVSFSPARDLPDSSLIQGAAHAIVAAITQRGNSSLLLAVTEVKVETLVVGGSSTGLLVPV
LCGAFSMLWLACVVLCVWWTRKRRKERERSRLPREESTNNQWAPLNPIRNPIERPGGGPW
GGGGHKDVLYHCKNFTPPPRGADDALPGPASHAGVREDEEDEDLGRGEEDSLEAEKFLSH
KFTKDPGHSPGRPARWASGPKVDNRAVRSINETRCAGRE
NT seq 3360 nt   +upstreamnt  +downstreamnt
atgcctgcccattggggaccaggagagctgtccaatctgcgctccttcaccctcatcgtg
gaggcctgggactgggacaacgacaccaccccgaatgaggagctgctgatcgagcgggtg
tcccacgccggcatgatcaaccccgaggaccgctggaagagcctgcacttcagcggccat
gtggcgcacctggagctgcagatccgcgtgcgctgcgatgagaactactacagcgccacc
tgcaacaagttctgccggccgcgcaacgacttctttggccactacacctgtgaccagtat
ggcaacaaggcctgcatggacggctggatgggccgggagtgcaaggaagctgtgtgtaaa
caagggtgtaatttgctccacggcggatgcagcgtacctggggagtgcaggtgcaactac
ggctggcaagggaggttctgtgacgagtgtgtgccctaccccggctgcgtgcacggcagc
tgcgtggagccgtggcagtgcagctgcgagaccaactggggcggcctgctttgcgacaaa
gacctgaactactgtggcaaccaccacccctgcaccaacggaggcacgtgcatcaatgcc
gagcccgaccagtaccgctgcacctgccccgacggctactcggggaggaactgtgagaag
gctgagcatgcctgcacctctaacccttgtgccaacgggggctcttgccatgaggtgcca
tctggctttgaatgccactgcccatcaggctggagcgggcccacctgtgcccttgacatt
gatgagtgtgcctcgaacccgtgtgcagccggtggtacctgtgtggaccaggtggatggc
ttcgagtgcatctgccccgagcagtgggtgggagccacctgccagctggacgccaatgag
tgtgaagggaagccgtgccttaatgctttttcttgcaaaaacctgattggcggctattac
tgtgattgcatcccgggctggaaaggcaccaactgccacatcaacatcaacgactgtcgt
gggcagtgtcagcacgggggcacctgcaaggacctagtgaacgggtaccagtgcgtgtgc
ccacggggctttggaggccggcactgcgagctgaagcgtgatgagtgtgccagcagccct
tgccgaagcggcggcctctgcgaggacctggccgacggcttccgctgccactgcccccag
ggcttctccgggcctctctgcgaggtggatgttgacctttgtgagccgagcccctgccgg
aacggtgctcgctgctataacctggagggcgactattactgcgcctgccccgatgacttt
gctggcaagaactgctctgtgccccgggagccgtgccctggtggggcctgcagagtgatc
gacggctgcgggttggacgcggggcccggggctcctagggcggcagcctccggcgtgtgc
ggcccccacggacgctgcgtcagccagcccgggggcaacttctcctgcgtgtgtgacagc
ggctttaccggcacctactgtcatgagaacatcgacgactgcctgggccagccctgccgc
aacgggggcacgtgcatcgacggggtggacgccttccgctgcttctgccccagcggctgg
gagggcgagctctgcgacaccaatcccaacgactgccttcccgatccctgccacagccgc
ggccgctgctacgacctggtcaacgacttctactgtgcgtgtgacgacggctggaagggc
aagacctgccactcacgcgagttccagtgcgatgcctacacctgcagcaacggtgggacc
tgctatgacagcggcgacaccttccgctgtgcctgcccccctggctggacgggcggcacc
tgcactgtagccaagaacagcagctgcttgcccaacccctgcgtgaatgggggcacctgc
gtgggcagtggggcctccttttcctgcatctgccgggatggctgggagggacgcacgtgc
acccacaataccaacgactgcaatcctctgccttgctacaacggtggcatctgtgttgac
ggcgtcaactggttccgctgcgagtgtgcgcctggcttcgcggggcctgactgccgcatc
aacattgacgagtgccagtcctcaccctgcgcctacggggccacgtgtgtggatgagatc
aacgggtatcgctgcagctgcccacccggccgagccggcctccggtgccaggaagtgatc
gggttcgggaggtcctgctggtcccggggcactcctttcccacacggaagctcctgggtg
gaagactgtaacagctgccgctgcctggacggccaccgtgactgcagcaaggtgtggtgc
gggtggaagccttgtctgctgtccggccagcccgaggccctgagcgcccagtgcccgctg
gggcagaggtgcctggagaaggccccaggccagtgtctgcgaccgccctgtgaggcctgg
ggagagtgcggcacagaagagccaccgagcaccccctgcctgcctcgctccggccacctg
gacaataactgcgcccgcctcaccttgcgcttcagtcgagaccatgtgccacagggcacc
acggtgggtgccatctgctctgggatccgctctctgccagccacgagggctgtggcacgg
gaccgcctgctagtgcttgtctgtgaccgggcgtcctcagaggccagcgccgtggaggtg
gctgtgtccttcagccctgccagggacctgcctgacagcagcctgatccagggtgcagcc
cacgccatcgtggccgccatcacccagcgggggaacagctcgctgctcttggctgtcact
gaggtcaaggtggagacgcttgtcgtgggaggctcttccacaggtctgctggtgcccgtg
ctatgtggagccttcagcatgctgtggctggcatgcgtggttctgtgcgtgtggtggaca
cgcaagcgcaggaaagagcgagagaggagccggctgccccgggaggagagcaccaacaac
cagtgggccccgctcaaccccatccgcaaccccattgaacggcctgggggcggcccctgg
ggcggcgggggccacaaggacgtgctctaccactgcaagaacttcacaccgccaccgcgc
ggggcggacgacgcgctgcctgggccagcgagtcacgccggcgtcagggaggacgaggag
gacgaggacctgggccgtggtgaggaggactccctggaagcggagaaattcctctcgcac
aaattcaccaaagatcctggccactcgccggggaggccggcccgctgggcctcaggcccc
aaagtggacaaccgcgcggtcaggagcatcaacgagacccgctgcgccggcagggagtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043243
Entry
101043243         CDS       T04350                                 

Gene name
JAG1
Definition
(RefSeq) protein jagged-1 isoform X1
  KO
K06052  jagged-1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04330  Notch signaling pathway
sbq04371  Apelin signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04668  TNF signaling pathway
sbq05165  Human papillomavirus infection
sbq05200  Pathways in cancer
sbq05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101043243 (JAG1)
   04371 Apelin signaling pathway
    101043243 (JAG1)
   04668 TNF signaling pathway
    101043243 (JAG1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101043243 (JAG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101043243 (JAG1)
  09162 Cancer: specific types
   05224 Breast cancer
    101043243 (JAG1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101043243 (JAG1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101043243 (JAG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:sbq04090]
    101043243 (JAG1)
CD molecules [BR:sbq04090]
 Proteins
  101043243 (JAG1)
SSDB
Motif
Pfam: EGF hEGF MNNL EGF_2 DSL EGF_CA cEGF
Other DBs
NCBI-GeneID: 101043243
NCBI-ProteinID: XP_003933248
UniProt: A0A2K6TGE2
LinkDB
Position
Unknown
AA seq 1218 aa
MRSPRARGRPGRPLSLLLALLCTLRAKVCGAAGQFEWELLSMQNLNGELQNGNCCGGARN
TGDRKCTRYECDTYFKVCLKEYQSRVTAGGPCSFGQGSTPVIGGNTFTFKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNNTLRPDNLIEKASHSGMINPSRQWQTLKQNTGIAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYTCDQNGNKTCMEGWMGSECNRAICRQGCST
KHGSCKHPGDCRCQYGWQGLYCDKCIPHPGCVHGICIEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGACSNTGPDKYQCSCPEGYSGVSCEIAEHACLSDPCHNRGSCKETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCQDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFMGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICT
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPPGHSGAKCQEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPR
PCLLHKGHSECPSGQSCIPILDDQCFVRPCTGVGECRSSGLQPVKTKCTSDSYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
IRDDGNPVKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRQPQKNRTDFLVPLLSSVLTVA
WICCLATALYWCLRKRRKPGSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNSTPTKHPNWTNKQ
DNRDLESAQSLNRMEYIV
NT seq 3657 nt   +upstreamnt  +downstreamnt
atgcggtccccacgggcgcgcggccggcccgggcgccccctaagcctcctgctcgccctg
ctctgtaccctgcgagccaaggtgtgcggggccgcgggtcagttcgagtgggagcttctg
tctatgcagaacctgaacggggagctgcagaacgggaactgctgcggcggcgcccggaac
acgggagaccgcaagtgtacccgctacgagtgtgacacatacttcaaagtatgcctcaag
gagtatcagtcccgcgtcacggccggggggccctgcagcttcggacaggggtccacgcct
gtcatcgggggtaacaccttcaccttcaaggccagccgcggcaacgaccgcaaccgcatc
gtactgcctttcagtttcgcctggccgaggtcctatacattgcttgtggaggcgtgggat
tccagtaataacacacttcgacctgacaatcttattgaaaaggcttctcactcgggcatg
atcaaccccagccggcagtggcagacactgaagcagaacacgggcattgcccactttgag
tatcagatccgtgtaacctgcgatgactactactatggctttggctgcaataagttctgc
cgccccagagatgacttctttggacactatacctgtgatcagaatggcaacaaaacttgc
atggaaggctggatgggctccgaatgtaacagagctatttgccgacaaggctgcagtacc
aagcatgggtcttgcaaacacccgggtgactgcaggtgccagtatggctggcaaggcctg
tactgtgataagtgcatcccgcacccaggatgcgtccatggcatctgtatcgagccctgg
cagtgcctctgtgagaccaactggggcggccagctctgtgacaaagatctcaattattgt
ggaacccatcagccgtgtctcaacgggggagcctgtagcaacacgggtcctgacaaatat
cagtgttcctgccctgagggatattcaggagtcagctgtgaaattgctgagcacgcctgc
ctctctgatccctgccacaacagaggcagttgtaaggagacctccctgggctttgagtgt
gagtgttccccaggctggactggccccacgtgctctacaaacattgatgactgttctccc
aataactgttcccacgggggcacctgccaggacctggttaatggatttaagtgtgtgtgc
cccccacagtggactggcaaaacgtgccagttagatgcaaatgaatgtgaggccaaacct
tgtgtaaatgccaaatcctgtaagaatctgattgccagctactactgcgactgtcttcct
ggctggatgggtcagaattgtgacataaatattaacgactgccttggccagtgccagaac
gatgcctcctgtcaggacttggttaatggttatcgctgtatctgtccacctggctatgca
ggcgatcattgtgagagagacatcgatgaatgtgccagcaacccctgtttgaatgggggt
cactgtcagaatgaaatcaacagattccagtgtctgtgtcccactggtttctctggaaac
ctctgtcagctggacatcgattattgtgagcccaatccctgccagaatggtgctcagtgc
tacaaccgcgccagcgactatttctgcaagtgccctgaggactatgagggcaagaactgc
tcacacctgaaagatcactgccgcacaaccccctgcgaagtgattgacagctgcacagtg
gccatggcttccaacgacacacctgaaggggtgcggtatatttcctcgaacgtctgtggt
ccccacgggaagtgcaagagtcagtcgggaggcaaattcacctgtgactgtaacaaaggc
ttcatgggaacatactgccatgaaaatattaatgactgtgagagcaacccctgtaaaaac
ggtggcacttgcatcgatggtgtcaactcctacaagtgcatctgtagcgacggctgggag
ggggcctactgtgaaaccaatattaatgactgcagccagaacccctgccacaatgggggc
acgtgtcgtgacctggtcaatgacttctactgtgactgtaaaaacgggtggaaaggaaag
acctgccactctcgtgacagtcagtgtgatgaggccacgtgcaacaatggtggcacctgc
tatgacgagggggatgcttttaagtgcatgtgtcccggcggctgggaaggaaccacctgt
aacatagcgcgaaacagtagctgccttcccaacccctgtcataatgggggcacatgtgtg
gtcaacggcgagtcctttacgtgcgtctgcaaggaaggctgggaggggcccatctgtact
cagaataccaatgactgcagccctcatccctgttacaacagcggcacctgtgtggatgga
gacaactggtaccggtgcgaatgtgccccgggttttgctgggcccgactgcagaataaac
atcaacgaatgccagtcttcaccttgtgcttttggggcaacctgtgtggatgagatcaat
ggctaccggtgtgtctgtccgccagggcacagtggtgccaaatgccaggaagtttcagga
agaccttgcatcaccatggggagtgtgataccagatggggccaaatgggatgatgactgt
aacacctgccagtgtctgaatggacggattgcctgctcaaaggtctggtgtggccctcga
ccttgcctgctccacaaagggcacagcgagtgccccagtgggcagagctgcatccccatc
ctggacgaccagtgcttcgtccgcccctgcactggtgtgggcgagtgtcggtcttccggt
ctccagccggtgaagacgaagtgcacctctgactcctattaccaggataattgtgcaaac
atcacgttcacctttaacaaggagatgatgtcaccaggtcttaccactgagcacatttgc
agtgaattgaggaatttgaatattttgaagaatgtttctgctgaatattcaatctatatc
gcttgtgagccttctccttctgcaaacaatgaaatacacgtggccatttctgctgaagat
atacgggatgatggaaacccagtcaaggaaatcaccgacaaaatcattgatcttgttagt
aaacgtgatggaaacagctcattgattgctgccgttgcagaagtaagagttcagaggcag
cctcagaagaacagaacagatttcctggtgcccttgctgagctctgtcttaaccgtggct
tggatctgttgcttggcgacggccttgtactggtgcctgcggaagaggcggaagccaggc
agccacacacactcagcctctgaggacaacaccaccaacaacgtgcgggagcagctgaac
cagatcaaaaaccccattgagaaacatggggccaacacggtccccatcaaggattatgag
aacaaaaactccaaaatgtctaaaataaggacacacaactctgaagtcgaagaggacgac
atggataaacaccagcagaaagcccggtttgccaagcagccagcttacacgctggtagac
agagaagagaagccccccaacagcacgccaacaaaacacccaaactggacaaacaaacag
gacaacagagacttggaaagtgcccagagcttaaaccggatggagtacatcgtatag

DBGET integrated database retrieval system