KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029484
Entry
101029484         CDS       T04350                                 

Gene name
HBEGF
Definition
(RefSeq) proheparin-binding EGF-like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04012  ErbB signaling pathway
sbq04912  GnRH signaling pathway
sbq04915  Estrogen signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq05171  Coronavirus disease - COVID-19
sbq05205  Proteoglycans in cancer
sbq05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101029484 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101029484 (HBEGF)
   04915 Estrogen signaling pathway
    101029484 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    101029484 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101029484 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    101029484 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101029484 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101029484 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101029484 (HBEGF)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101029484 (HBEGF)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 101029484
NCBI-ProteinID: XP_003933954
UniProt: A0A2K6U8I7
LinkDB
Position
Unknown
AA seq 208 aa
MKLPPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTESTDQLLPLGGGRDWK
VRDLQEADLDLLRVTLSSKPQALATPSKEEHGKRKKKSKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctaccgccgtcggtggtgctgaagctctttctggctgcagttctctcggcgcta
gtgactggcgagagcctggagcggcttcggagagggctggctgctggaaccagcaacccg
gaccctcccactgaatccacggaccagctgctacccctaggaggcggccgggactggaaa
gtccgtgacttgcaagaggcagatctggaccttttgagagtcactttatcctccaagcca
caagcactggccacaccaagcaaggaggagcatgggaaaagaaagaaaaagagcaagggc
ttagggaagaagagggacccatgtcttcggaagtacaaggacttctgcatccatggagaa
tgcaaatacgtgaaggagctccgggctccctcctgcatctgccacccgggttatcatgga
gagaggtgtcatgggcttagcctcccagtggaaaatcgcttatatacctacgaccacaca
accatcctggccgtggtggctgtggtgctgtcgtctgtttgtctgctggtcatcgtgggg
cttctcatgtttaggtaccataggagaggaggctatgatgtggagaatgaagagaaagtg
aagttgggcatgactaattcccactga

DBGET integrated database retrieval system