KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029493
Entry
101029493         CDS       T04350                                 

Gene name
ILK
Definition
(RefSeq) integrin-linked protein kinase isoform X1
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04360  Axon guidance
sbq04510  Focal adhesion
sbq05100  Bacterial invasion of epithelial cells
sbq05213  Endometrial cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101029493 (ILK)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101029493 (ILK)
  09158 Development and regeneration
   04360 Axon guidance
    101029493 (ILK)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    101029493 (ILK)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101029493 (ILK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101029493 (ILK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101029493 (ILK)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101029493 (ILK)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: TKL group
  MLK family
   101029493 (ILK)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101029493 (ILK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ank_4 Ank_5 Pkinase Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 101029493
NCBI-ProteinID: XP_010336117
UniProt: A0A2K6TPF0
LinkDB
Position
Unknown
AA seq 483 aa
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRGPSPHPLTCALLSLPTCLLPLYHSSGCFSSL
ERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWK
GRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLIT
HWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDE
DMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTRE
VPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKM
QDK
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaacgcagtcgccgttcgcctgtggctg
gacaacacggagaacgacctcaaccagggggacgatcatggcttctcccccttgcactgg
gcctgccgagagggccgctctgctgtggttgagatgctgatcatgcggggggcacggatc
aatgtaatgaaccgtggggatgacacccccctgcatctggcagccagtcatggacaccgt
gatattgtacagaagctattgcagtacaaggcagacatcaatgcagtcaatgaacatggg
aacgtgcccctgcactatgcctgtttttggggccaagaccaagtggcagaggacctggtg
gcaaatggggcccttgtcagcatctgtaacaagtatggagagatgcctgtggacaaagcc
aaggcacccctgagagagcttctccgaggtccatctccccacccgctaacttgtgctctc
ttgtcccttcccacctgtcttcttcctctgtaccacagctcaggttgtttttcttcccta
gagcgggcagagaagatgggccagaatctcaaccgtattccatacaaggatacgttctgg
aaggggaccacccgcactcggccccgaaatggaaccctgaacaaacactctggcattgac
ttcaaacagctgaacttcctgacgaagctcaacgagaatcactctggagagctatggaag
ggccgctggcagggcaatgacattgtcgtgaaggtgctgaaggttcgagactggagtaca
aggaaaagcagggacttcaatgaagaatgtccccggctcaggattttctcgcatccaaat
gtgctcccagtgctaggtgcctgccagtctccacctgctcctcatccgaccctcatcaca
cactggatgccatatggatccctctacaatgtactacatgaaggcaccaattttgttgtg
gaccagagccaggctgtgaagtttgctttggacatggcaaggggcatggccttcctacac
acactagaacccctcattccacgacatgcactgaatagccgtagtgtaatgattgatgag
gacatgactgcccgaattagtatggctgatgtcaagttctctttccaatgtcctggtcgc
atgtatgcacctgcctgggtagcccctgaagctctgcagaagaagcctgaagacacaaac
agacgctcagcagacatgtggagttttgcagtgcttctgtgggaactggtgacacgggag
gtaccctttgctgatctctccaatatggagattggaatgaaggtggcattggaaggcctt
cggcctaccatcccaccaggtatttcccctcatgtgtgtaagctcatgaagatctgcatg
aatgaagaccctgcaaagcgacccaaatttgatatgattgtgcctatcctggagaagatg
caagacaagtag

DBGET integrated database retrieval system