KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029503Help
Entry
101029503         CDS       T04350                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00512  Mucin type O-glycan biosynthesis
sbq01100  Metabolic pathways
Module
sbq_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101029503 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sbq01003]
    101029503 (GALNT9)
Enzymes [BR:sbq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     101029503 (GALNT9)
Glycosyltransferases [BR:sbq01003]
 O-Glycan biosynthesis
  Mucin-type
   101029503 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 101029503
NCBI-ProteinID: XP_010345972
LinkDB All DBs
Position
Unknown
AA seq 516 aa AA seqDB search
MPWSRSLPPAGSLLGSPWGCGRQGGQEGRLPGRPLRVPGLTSLSSFPPGLAKPIGLVEGP
GGLGQGGLAATLRDDGQEVEGSYEEFGYNAQLSDRISLDRSIPDYRPRKCRQMTYARDLP
QVSVVFIFVNEALSVILRSVHSVVNHTPSRLLKEVILVDDNSDNVELKFNLDQYVNKRYP
GLVKIVRNSRREGLIRARLQGWKAATAPVVGFFDAHVEFNTGWGLMPTSLPPRTPAMIGC
SFVVDREYFGDIGLLDPGMEVYGGENVELGMRVWQCGGSMEVLPCSRVAHIERTRKPYNN
DIDYYAKRNALRAAEVWMDDFKSHVYMAWNIPMTNPGVDFGDVSERLALRQKLKCRSFKW
YLENVYPEMRTYNNTLTYGEVRNSKASGYCLDQGAEDDDRAILYPCHGMSSQLVRYSADG
LLQLGPLGSTAFLPDSKCLVDDGRGRTPTLKKCEDVARPAQRLGDFTQSGPIVSRATGRC
LEVEMSKDANFGLRLVVQRCSGQKWMIRNWIKHSQH
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgccctggagccggagcctgccacctgcagggagtttgctgggctcgccctggggatgc
ggccgtcagggagggcaggaagggcgtctcccggggcggccgctgcgcgtcccgggcctg
acttccctctcttcgttccccccaggcctcgccaagcccatcggcctggtggaggggccg
gggggcctgggccagggcggcttggcggccaccctgcgtgacgacggccaggaggtggaa
ggcagctatgaggagttcgggtacaacgcccagctcagcgaccgcatctccctggaccgg
agcatccctgactaccggccccgaaagtgccgacagatgacctacgcccgggacctgccc
caggtctctgtggtcttcatcttcgtcaacgaggcgctgtcggtcatcctgcgctccgtg
cacagcgtggtcaaccacacgccctcccggctgctcaaggaggtcatcctggtggatgac
aacagcgacaacgtggagctcaagttcaatctggaccagtacgtcaacaagcggtacccg
ggcctcgtgaagatcgtccggaacagccggagggaagggctgatccgcgcccggctgcag
ggctggaaggcggccaccgccccggtcgtcggcttcttcgacgcccacgtggagttcaac
acaggctggggcctcatgccgacatctctgcctcccaggaccccagccatgatcggctgc
tcctttgtggtggaccgtgaatacttcggggacatcgggctgctggaccccggcatggag
gtgtacggcggtgagaacgtggagctgggcatgagggtgtggcagtgtggcggcagcatg
gaggtcctgccctgctcgcgcgtggcccacatcgagcgcaccaggaagccctacaacaac
gacatcgactactacgccaagcgcaacgccctgcgcgccgccgaggtgtggatggacgac
ttcaagtcccacgtgtacatggcctggaacatccccatgacgaacccaggggtggacttc
ggagacgtgtccgagaggctggccctgcgccagaagctgaagtgtcgcagtttcaagtgg
tacctggagaacgtgtacccggagatgaggacgtacaacaacacgctcacgtacggagag
gtgagaaacagcaaagccagtggctactgcttggaccagggagcggaggacgatgaccga
gcgatcctctacccctgccacgggatgtcctcccagctggtgcggtacagcgctgacggc
ctgctgcagctggggcctctgggctccacggctttcctgcccgactctaagtgtctggtg
gatgacggcaggggccgcacgcccaccctgaagaagtgcgaggatgtggcacggccagca
cagcggctgggggacttcacccagagcggccccattgtgagccgggccacgggccgctgc
ctggaggtggagatgtccaaagacgccaacttcgggctccggctggtagtgcagaggtgc
tcggggcagaagtggatgatcagaaactggatcaaacacagccagcactga

DBGET integrated database retrieval system