KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029550
Entry
101029550         CDS       T04350                                 

Gene name
CCR5
Definition
(RefSeq) C-C chemokine receptor type 5
  KO
K04180  C-C chemokine receptor type 5
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04062  Chemokine signaling pathway
sbq04144  Endocytosis
sbq05145  Toxoplasmosis
sbq05163  Human cytomegalovirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101029550 (CCR5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101029550 (CCR5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101029550 (CCR5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101029550 (CCR5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101029550 (CCR5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101029550 (CCR5)
   05163 Human cytomegalovirus infection
    101029550 (CCR5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101029550 (CCR5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101029550 (CCR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sbq04030]
    101029550 (CCR5)
   04050 Cytokine receptors [BR:sbq04050]
    101029550 (CCR5)
   04090 CD molecules [BR:sbq04090]
    101029550 (CCR5)
G protein-coupled receptors [BR:sbq04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    101029550 (CCR5)
Cytokine receptors [BR:sbq04050]
 Chemokine receptors
  CC Chemokine
   101029550 (CCR5)
CD molecules [BR:sbq04090]
 Proteins
  101029550 (CCR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 101029550
NCBI-ProteinID: XP_003926315
LinkDB
Position
Unknown
AA seq 352 aa
MDYQVSSPIYDIDYGPSEPCRKIDVKQMGAQLLPPLYSLVFLFGFVGNMLVVLILINCKR
LKSMTDIYLLNLAISDLLFLFTIPFWAHYAAGQWDFGNTMCQFLTALYFIGFFSGIFFII
LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGYHYSCSP
HFPFSQYRFWKNFETLKMVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLINTYPDFFGVNNCNSSNRLDQAMQVTETLGMTHCCVNPIIYAFV
GEKFRNYLVIFFQKHIAKRFCKCCSIFQKEAPERANSVYTRSTGEQEISVGL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggattaccaagtgtcaagtccaatctatgacatcgattatggtccatcggagccctgc
cgaaaaatcgacgtgaagcaaatgggagcccagctcctgcctccactctactcgctggtg
ttcctctttggctttgtgggtaacatgctggtcgtcctcattctgataaactgcaaaagg
ctgaagagcatgactgacatctacctgctcaacttggccatctctgacctgcttttcctt
tttaccatccccttctgggctcactatgctgcaggccagtgggactttggaaatacaatg
tgtcaattcttgacagcactctattttataggcttcttctctggaatcttcttcatcatc
ctcctgacaatcgataggtacctggctatcgtccatgctgtgtttgctttaaaagccagg
acggtcacgtttggggtggtgacaagtgtgatcacttgggtggtggctgtatttgcctct
ctcccaggaatcatcttcaccaggtctcaaaaagaaggttatcattacagctgtagccct
cattttccattcagtcagtatcgattctggaagaatttcgagacattaaagatggtcatc
ttggggctggtcctgccgctgctcgtcatggtcatctgctactcgggaatccttaaaacc
ctgcttcggtgtcgaaatgagaagaagaggcacagggctgtgaggctcatcttcaccatc
atgattgtttattttctcttctgggctccctacaacattgtccttctcataaacacctac
ccggatttctttggcgtgaataattgcaatagctctaacaggttggaccaagccatgcag
gtgacagagactcttgggatgacacattgctgtgtcaaccccatcatctatgcctttgtt
ggggagaagtttagaaactacctcgtgatcttcttccaaaagcacattgccaagcgcttc
tgcaaatgctgttccatattccagaaagaggctcccgagcgagcaaactcagtttacacc
cgatccaccggggagcaggaaatatctgtgggcttgtga

DBGET integrated database retrieval system