KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029701
Entry
101029701         CDS       T04350                                 

Gene name
ACOX3
Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 3
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00071  Fatty acid degradation
sbq00410  beta-Alanine metabolism
sbq00592  alpha-Linolenic acid metabolism
sbq00640  Propanoate metabolism
sbq01040  Biosynthesis of unsaturated fatty acids
sbq01100  Metabolic pathways
sbq01200  Carbon metabolism
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04024  cAMP signaling pathway
sbq04146  Peroxisome
Module
sbq_M00087  beta-Oxidation
sbq_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    101029701 (ACOX3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101029701 (ACOX3)
   00592 alpha-Linolenic acid metabolism
    101029701 (ACOX3)
   01040 Biosynthesis of unsaturated fatty acids
    101029701 (ACOX3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101029701 (ACOX3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101029701 (ACOX3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101029701 (ACOX3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101029701 (ACOX3)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     101029701 (ACOX3)
SSDB
Motif
Pfam: ACOX Acyl-CoA_dh_1 Acyl-CoA_dh_M
Other DBs
NCBI-GeneID: 101029701
NCBI-ProteinID: XP_010343614
LinkDB
Position
Unknown
AA seq 788 aa
MAPTVEGRDATLFPEFPRGPLDTYRARASFSWKELALFTEGEDVLRFKKTIFSALEIDPL
FARSPGAHLSLEKYRELNFLRCKRIFEYDFLSAGDVFESPLKVSTLIQCLGMYDWSLAAK
YLLHTLIFGSVVVSAGSERHFAYIPKIFSMEIFGCFALTELSHGSNTKAIRTTAHYNPAT
EGALWRLSLPAVCPLWLALCEQPALSVPAIMHGLNVDSAWSTVWKSPVMKPGGPRPGQGR
EAVLARHAPAVGLREERVTGGGSGTRARTYRDSQPLAVTGHGGWGSVSPEAAQGSFVGHL
RAVCPKLPFAAFCGFVQIRDPKTLFPMPGVMVGDIGKKLGQNGLDNGFAVFHKVRVPRQS
LLNRMGDVTPEGTYVSPFKDARQRFGASLGSLSWGRVTIMGMAVTNLKLALSIAVRFSAT
RRQFGPTEDEEIPVLEYQTQQWRLLPYLAAAYALDHFSKSLFVDLVELQRGLAAGDRSAR
QAELGREIHALASAGKPLASWTAQQGIQECREACGGHGYLAVNRLGVLRDDNDPNCTYEG
DNNVLLQQTSNYLLGLLACRVQDGACFRSPLKSVDFLDSYPGILDQRFEVSSVADCLDSA
VALAAYKWLVCYLLRETHEKLNQEKRSGSDDFEARNNCQVFHGRPLALAFMELTVLQRFH
EHVHQPCVPPSLRAVLGRLSALYALWSLNCHAALLYRGGYFSGEQAGRVLESAILTLCSQ
LKDDAVALVDVIAPPDFILDSPIGRADGELYKNLWGAVLQDSKVLERASWWPEFSVNKPV
TGSLKSKL
NT seq 2367 nt   +upstreamnt  +downstreamnt
atggcgcccaccgtggaaggacgtgacgcgaccctgttcccagaatttcccaggggaccc
ctcgacacctatcgcgcaagagcgtccttcagctggaaggagctggcgctgttcacggaa
ggggaggatgtgctccgctttaagaaaaccatcttctcagctcttgagatcgaccctctt
ttcgcccgttcccctggagcccatctgtccttggagaagtaccgtgagctgaacttcctc
cgatgcaagcggatcttcgagtatgacttcctcagcgcaggagacgtgttcgagagccca
ctgaaggtctccaccttgattcagtgcctggggatgtatgactggtccctggctgccaag
tacctccttcataccttgatttttggatcagtggtggtcagtgctggttctgaaaggcac
ttcgcctacattccaaagatcttcagtatggagatctttggatgttttgctctgaccgaa
ttaagccacggcagtaacaccaaggccatccgcacgaccgcccactacaaccctgccact
gagggggccctgtggagactctcgctccctgccgtctgccctttgtggctggccctctgc
gaacagcctgccttgtctgttcctgccatcatgcatgggctgaatgtggactctgcctgg
agtactgtgtggaagagcccagtgatgaaaccaggcggaccccggccagggcagggacga
gaggcggtcctcgcacggcacgctcctgctgtggggcttcgcgaagaacgagtgacaggt
ggagggtcgggaaccagagccagaacttaccgtgacagccagcccctggcagtgactggc
catggaggctggggatcagtgtctcccgaggcggcccagggcagctttgtgggccacctg
cgggctgtctgcccgaagttgccgtttgctgccttctgtggctttgtacagatccgggac
ccgaagacccttttccccatgcccggagtgatggttggcgacatagggaagaaacttggg
cagaacggtctggataacggattcgctgtgttccacaaggtcagagttcctcgccagagc
ctcctgaaccggatgggagacgtcacccctgagggcacctacgtcagcccctttaaggac
gccaggcagcgcttcggagcgtccctggggagcctgtcctggggccgggtcaccatcatg
ggcatggcggtcactaacttgaagctggccttgtccatcgcagttcgcttctcagccact
cggcgtcagtttggaccaacagaggatgaggaaatcccagtgcttgagtatcagacgcag
caatggcgcttgcttccatatctggcagctgcctacgccttagaccacttctccaagtcg
ctcttcgtggacctggtggagctccagcgaggccttgcagcgggagaccgcagcgccaga
caggcagagctcggacgtgagatccacgctctggcgtcagcgggcaagcccctggcctcg
tggaccgcccagcaaggaattcaggaatgccgggaggcgtgcgggggacatggctatctg
gccgtgaaccgcttgggggtcctcagagatgacaacgatcccaactgcacatatgaaggt
gacaacaacgtcctgctgcagcagacaagcaactatttgctgggcctcctggcgtgccgg
gtccaggatggagcttgcttccgcagtccgctgaagtcagtggactttctggacagctat
cccggcatccttgaccagaggtttgaggtctccagcgttgctgactgcttggactccgca
gtcgccctggcagcatacaagtggctggtttgctacctgctccgagagactcatgaaaaa
ttaaaccaagagaagagatcaggaagcgatgactttgaagcaaggaacaactgccaggtg
ttccacggccgccccttggcgctggccttcatggagctcacggtgctgcagaggttccac
gagcacgtgcaccagccctgcgtgccgccctcactgcgggccgtgctggggcggctcagt
gctctctatgccctgtggtccctgaactgccatgcggccctgctctaccgaggtggatac
ttctccggtgagcaggcgggaagagttctggagagtgccatcctgaccctgtgttcccag
ctgaaagacgacgcagttgccctggtggacgtgatcgctcctccggacttcattctggac
tcaccgattggcagagccgacggcgagctctacaaaaacctctggggcgctgtcctgcag
gacagcaaggtgttggagcgggcgtcctggtggccggagttttctgtgaacaaacctgtc
acaggaagtctgaaatcgaagctgtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036109
Entry
101036109         CDS       T04350                                 

Gene name
ACOX1
Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1 isoform X1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00071  Fatty acid degradation
sbq00410  beta-Alanine metabolism
sbq00592  alpha-Linolenic acid metabolism
sbq00640  Propanoate metabolism
sbq01040  Biosynthesis of unsaturated fatty acids
sbq01100  Metabolic pathways
sbq01200  Carbon metabolism
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04024  cAMP signaling pathway
sbq04146  Peroxisome
Module
sbq_M00087  beta-Oxidation
sbq_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    101036109 (ACOX1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101036109 (ACOX1)
   00592 alpha-Linolenic acid metabolism
    101036109 (ACOX1)
   01040 Biosynthesis of unsaturated fatty acids
    101036109 (ACOX1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101036109 (ACOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101036109 (ACOX1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101036109 (ACOX1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101036109 (ACOX1)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     101036109 (ACOX1)
SSDB
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Other DBs
NCBI-GeneID: 101036109
NCBI-ProteinID: XP_003931907
UniProt: A0A2K6U6C7
LinkDB
Position
Unknown
AA seq 659 aa
MNPDLRRERDSASFNPELLTHILDGSPENTRRRREIENMILNDPDFQHEDLNFLSRSQRY
EVAVRKSAIMVKKMREFGIADPDEIMWFKNFVHRGRPEPLDLHLGMFLPTLLHQATAEQQ
ERFFMPAWNLEIIGTYAQTEMGHGTHLRGLETTATYDPKTQEFILNSPTVTSIKWWPGGL
GKTSNHAIVLAQLITKGKCYGLHAFIVPIREIGTHKPLPGITVGDIGPKFGYDEMDNGYL
KMDNYRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGEAARALSKACTIA
IRYSTVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYYRINEGIG
QGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPTCTF
EGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPNMVDINSP
DSLTEAYKLRAARLVEIAAKNLQAEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFS
EKLLKIQDKAIQAVLRKLCLLYSLYGISQNTGDFLQGSIMTESQITQVNQRVKELLTLIR
SDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVKSNIFAPFLKSSL
NT seq 1980 nt   +upstreamnt  +downstreamnt
atgaaccccgacctgcgcagggagcgggactccgccagcttcaacccggagctgcttaca
cacatcctggacggcagccccgagaatacccggcgccgcagagagatcgagaacatgatc
ctgaacgacccagacttccagcatgaggacttgaacttcctatctcgcagccagcgttat
gaggtggctgtcaggaagagtgccatcatggtgaagaagatgagggagtttggcatcgca
gaccctgatgaaatcatgtggtttaaaaattttgtgcaccgagggcggcctgagcctctg
gatcttcacttgggcatgttcctgcccaccttgcttcaccaggcaactgcggagcagcag
gagcgcttcttcatgcccgcctggaacttggagatcattggcacttatgcccagacagag
atgggtcatggaactcatcttcgaggcttggaaaccacagccacatatgaccctaaaacc
caggagttcattctcaacagtcctactgtgacctccattaaatggtggccgggtggactt
ggaaagacttcaaatcatgcaatagttcttgcccagctcatcactaaggggaaatgctat
ggattacatgcctttattgtacctattcgtgaaatcgggacccataaacctttgccagga
attactgttggtgacattggccccaaatttggttatgatgagatggacaatggctacctc
aaaatggacaactatcgtattcccagagaaaacatgctgatgaagtatgcccaggtgaag
cctgatggcacgtatgtgaaaccgctgagtaacaagctgacttatgggaccatggtgttt
gtcaggtccttccttgtgggagaagctgctcgggctctgtctaaggcatgcaccattgcc
atccgatacagcactgtgaggcaccagtctgaaatcaagccaggtgaaccagaaccgcag
attttggattttcaaacccagcagtataaactctttccgcttctggccactgcctatgcc
ttccagtttgtgggcgcatacatgaaggagacctattaccggattaacgaaggcattggt
caaggggacctgagtgaactccctgagcttcatgccctcaccgccggacttaaggctttc
acctcctggacggcaaacactggcattgaagcatgtcggatggcttgtggtgggcatggc
tattctcattgcagtggtcttccaaatatttatgtcaatttcaccccaacctgtacattt
gagggagaaaacactgtgatgatgctacagacggctaggttcctgatgaaaagttatgac
caggtgcactcaggaaaactggtgtgtggcatggtgtcctatttgaatgacctgcccagt
cagcgcatccagccacagcaggtagcagtctggccaaacatggtggacatcaacagccct
gacagcctaacggaagcatataaactccgtgcagccagattagtagaaattgctgccaaa
aaccttcaggcagaggtgattcacagaaaaagcaaggaggtagcatggaacctaacttct
gttgacctcgttcgagcgagtgaggcacattgccactatgtggtagttaagctcttttca
gaaaaactcctcaaaatccaagataaagccattcaggctgtcttaaggaagttatgtctg
ttgtattctctgtatggaatcagtcagaatacaggggattttcttcaggggagcatcatg
acagagtctcagattacccaagtaaaccagcgtgtaaaggagttactcactctgattcgc
tcagatgctgttgctttggttgatgcatttgattttcaggatgtgacgcttggctctgtg
cttggccgctatgatgggaatgtgtatgaaaacttgtttgagtgggctaagaactcccca
ctgaacaaagcagaggtaaaatccaatatctttgcaccttttttaaagtcttcactttaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051802
Entry
101051802         CDS       T04350                                 

Gene name
ACOX2
Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 2
  KO
K10214  3alpha,7alpha,12alpha-trihydroxy-5beta-cholestanoyl-CoA 24-hydroxylase [EC:1.17.99.3]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00120  Primary bile acid biosynthesis
sbq01100  Metabolic pathways
sbq03320  PPAR signaling pathway
sbq04146  Peroxisome
Module
sbq_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
sbq_M00862  beta-Oxidation, peroxisome, tri/dihydroxycholestanoyl-CoA => choloyl/chenodeoxycholoyl-CoA
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    101051802 (ACOX2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101051802 (ACOX2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101051802 (ACOX2)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.99  With unknown physiological acceptors
    1.17.99.3  3alpha,7alpha,12alpha-trihydroxy-5beta-cholestanoyl-CoA 24-hydroxylase
     101051802 (ACOX2)
SSDB
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Other DBs
NCBI-GeneID: 101051802
NCBI-ProteinID: XP_003943159
UniProt: A0A2K6SVM1
LinkDB
Position
Unknown
AA seq 681 aa
MGSPVHRVSLGDTWSRQMHPDIESERHIQSFDVERLTNILDGGAQNTELRRKVESIIHSY
PEFSRKDDYFMTQNERYKAAMRRAFHIRLIAQRLGWLADGRELGYAYRALSGDVALNIHG
VFQKALRSLGTEEQIAKWDPLCKNIQIIATYAQTELGHGTYLQGLETEATYDAATQEFVI
HSPTLTATKWWPGDLGRSATHALVQAQLICSGARRGMHAFIVPIRSLQDHAPLPGITVGD
IGPKMDFDQTDNGFLQLNHVRVPRENMLSRFAQVLPDGTYVKLGTAQSNYLPMVVVRVEL
LLGEILPLLQKACVIATRYSVIRRQSQLRPSDQEAKVLDYQTQQQKLFPQLAISYAFHFL
AVSLLEFFQRSYSAILNRDFHILPELHALSTGMKAMMSDFCTQGAEMCRRACGGHGYSKL
SGLPSLVTKVSASCTYEGENTVLYLQVARFLVKNYLQTQMSPGSAPQRSLPPSVAYLTAP
VLARCPAQRAADFLCPKLYTTAWAHVAARLIKDSVHHLQTLTQSGADQHEAWNQTTVIHL
QAAKAHCYYVTVKGFAEALEKLENEPAIQQVLKRLCDLHAIHGILTNSGDFLHDSFLSGA
QVDMARTAYLDLLCLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNT
QENPAYEEYIRPLLQSWRSKL
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgggcagcccagtgcaccgagtatcattgggggacacctggagcagacaaatgcacccc
gacatagagagcgagaggcatatacagtcctttgacgtggaacggctcaccaacatcctt
gatggaggtgcccagaacactgagctccggaggaaagttgagagcatcatccacagttat
ccagagtttagccgtaaggacgattatttcatgacccagaatgagcgttataaggctgcc
atgcggagggcattccacatccgattgatagcacagcgcctgggttggttggcagatggt
cgtgaattaggctatgcttacagagccctttctggagacgtggccttaaatatacacgga
gtcttccagaaagccctcaggagtctgggcacagaggagcagattgccaaatgggaccca
ctctgcaaaaacatccagatcatcgcaacatatgctcagaccgagttgggacatgggacc
taccttcagggtctggagactgaagccacctatgacgcagccacccaggagtttgtgata
cacagccccacgctgactgccaccaagtggtggcctggagacttgggacggtcagccacc
cacgccctggtccaggcccagctgatctgctcaggagcccggcggggcatgcacgctttt
attgtgcctatccggagtcttcaggaccacgccccgctgccaggaatcaccgttggggac
atcgggcccaagatggactttgatcaaacagacaatggctttctgcagctgaaccatgtg
cgagtccccagggagaacatgctgagtcgctttgcacaggtcttgccagatggcacctat
gtcaaactcggaacagcacagagcaactaccttcccatggtggtggtgcgggtagagctg
ctgctgggggagatcctccctctactacagaaggcctgtgtcatcgccacgcgctactct
gtcatccgccgccaatcccaactccggcccagtgaccaagaggcaaaggtcctggactac
cagacgcagcaacagaaactctttcctcagctggccatcagttatgccttccacttcctg
gcggtcagcctcttggagttctttcagcgctcctacagtgccattctgaacagagacttc
cacatcctgcccgagctccacgcactgagcacaggcatgaaggccatgatgtcagacttc
tgcacccagggagctgagatgtgccgcagggcctgtggcggacacggctactctaagctg
agtggcctgccatcactggtcaccaaagtgtctgcctcttgcacctatgagggtgagaac
acagtgctctacctgcaggtggccaggtttctggtgaagaactacctgcagactcagatg
tcccctggctccgcaccgcagagatctctccctccatctgtcgcctatctcaccgcacct
gtcctggccaggtgtccagcccagagggcagccgacttcctctgcccgaagctctacacc
acggcctgggcacacgtggcagcaaggctgataaaggactcagtgcaccatttacagacc
ctgacgcaatccggagctgaccagcacgaggcctggaaccagaccactgtcatacacctc
caggctgctaaggcacactgctactatgtcactgtgaagggttttgcagaagctctggag
aaactagaaaatgaaccagcgattcagcaggtgctcaaacgtctctgtgacctccatgcc
atacatggaatcttgactaactcgggtgactttctccatgattccttcctgtctggtgcc
caagtggacatggcaagaacagcctacctggacctgctgtgcctgatccggaaggatgcc
atcctattaactgatgcttttgacttcacggatcagtgtttaaattcagcacttggctgt
tatgacggaaatgtctatgaacgcctgttccagtgggctcagaagtcaccaaccaatact
caggagaaccctgcctatgaggaatatataagaccactattacaaagttggagatccaag
ctatga

DBGET integrated database retrieval system