KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029836
Entry
101029836         CDS       T04350                                 

Gene name
STAT2
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04062  Chemokine signaling pathway
sbq04217  Necroptosis
sbq04380  Osteoclast differentiation
sbq04621  NOD-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101029836 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101029836 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101029836 (STAT2)
   04625 C-type lectin receptor signaling pathway
    101029836 (STAT2)
   04062 Chemokine signaling pathway
    101029836 (STAT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101029836 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101029836 (STAT2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101029836 (STAT2)
   05160 Hepatitis C
    101029836 (STAT2)
   05171 Coronavirus disease - COVID-19
    101029836 (STAT2)
   05164 Influenza A
    101029836 (STAT2)
   05162 Measles
    101029836 (STAT2)
   05168 Herpes simplex virus 1 infection
    101029836 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101029836 (STAT2)
   05169 Epstein-Barr virus infection
    101029836 (STAT2)
   05165 Human papillomavirus infection
    101029836 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101029836 (STAT2)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101029836 (STAT2)
SSDB
Motif
Pfam: STAT_alpha STAT2_C STAT_int STAT_bind SH2
Other DBs
NCBI-GeneID: 101029836
NCBI-ProteinID: XP_010348321
LinkDB
Position
Unknown
AA seq 776 aa
MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAVLGNDESKATMLF
FHFLDQLNYECGRCSQDPESLLLQHNLRKFCRDIQAFSQGPTQLAEMIFNLLLEEKRILN
QAQRAQLEQGQPVLETPVESQQHAIESRILDLKAMMEKLVKSISQLKDQQDVFCFRYKIQ
AKGKTSSLGPHQIKEQKILQETLNELDKKRKEVLDASKALLGRLTTLIELLLPKLEEWKA
QQQKACIGAPVDHGLAQLEKWWLLVRLQEGNESLTVEVSIDRNPQLQGFRKFNILTSNQK
TLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSTKGPLSVTEELHIISFTVQYTYQGLKQ
ELKTDTLPVVIISNMNQLSIAWASVLWFNLLSPNLENQQFFSSPPKAPWSLLGPALSWQF
SSYVGRGLNSDQLSMLKNKLFGQNCKTEDALLSWADFTKRESPPGKLPFWTWLDKILELV
HDHLKDLWNDGLIMGFVSRSQERRLLKKTISGTFLLRFSESSEGGITCSWVEHQDDDKVL
IYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNL
QERRKYLKHRLIVVSNRQVDELQQPLELKPEPEPELEWLKPEPELESLKPEPGLVPELDL
DLESLLKAGLDLGPALESVLESTLDPVMEPTLCTVSQTVPQPDQGPVSQPVPEPDLPCDL
RHLNTEPMEIFRNCIKIEEIMPNGDPLLAGQNTMDEAFVSRPSHFYTDGSLMPSDF
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggcacagtgggagatgctgcagaatcttgacagcccctttcaggaccagctgcaccag
ctttactcacacagcctcctgcctgtggacattcgacagtacttggctgtctggattgaa
gaccagaattggcaggaagctgtactggggaatgatgagtccaaggctaccatgctattc
ttccacttcttggatcagctgaactatgagtgtggccgctgcagccaggacccagagtcc
ttgttgctacagcacaatttacggaaattctgccgggacattcaggccttttcccagggc
cctacccagctggctgagatgatctttaacctccttctggaagaaaaaagaattctgaac
caggctcagagggctcaactggagcaaggacaaccagttcttgaaacacctgtggagagc
cagcaacatgcgattgaatcccggatcctggatttaaaggctatgatggagaagctggta
aaatccatcagccaactgaaagaccaacaggatgtcttctgcttccgatataagatccag
gccaaagggaagacatcctctctgggcccccatcagatcaaagagcagaagattctgcag
gaaactctcaatgaactggacaaaaagagaaaggaggtgctggatgcctccaaagcactg
ctaggccgattaactaccctaatcgagctactgctgccaaagttggaggagtggaaagcc
cagcagcaaaaagcctgcattggagctcctgttgaccatggattggcacagctggagaaa
tggtggctgctggtgagactccaggaaggcaatgagtcactgactgtggaagtttccatt
gacagaaatcctcaattacaaggcttccggaagttcaacattctgacttcaaaccagaaa
actttgacccccgagaaggggcagagtcagggtttgatttgggactttggttatctgact
ctggtggagcaacgttcaggtggttcaggaaagggcagcactaaggggccactaagtgtg
acagaggaactgcacatcatcagcttcacagtccaatacacctaccagggtctgaaacag
gagctgaaaacggacaccctccctgtggtgattatttccaacatgaaccaactctcaatt
gcctgggcttcagttctctggttcaatttgctcagcccaaaccttgagaaccagcagttc
ttctccagcccccccaaggccccctggagcctgctgggccctgctctcagttggcagttc
tcctcgtatgttggccgaggcctcaactcagaccagctgagcatgctgaaaaacaagctg
tttgggcagaactgcaagacggaggatgcattgctgtcctgggctgacttcactaagcga
gagagtcctccaggcaagctaccattctggacatggctggacaaaattctggagttggta
catgaccacctgaaggatctctggaatgatggactgatcatgggctttgtgagtcggagc
caggagcgccggctgctgaagaagaccatctctggcacctttctactgcgcttcagtgaa
tcgtcagaagggggcattacctgctcctgggtggagcaccaagacgatgacaaggtgctc
atctactctgtgcaaccctacaccaaggaggtgctgcagtcactcccgctgactgaaatc
atccgccattaccagttgctcacggaagaaaacatacctgagaacccactgcgcttcctc
tatccccgaatcccccgggacgaagcttttgggtgctactaccaggagaaagttaatctc
caggaacggagaaaatacctgaaacacaggctcattgtggtctctaatagacaggtagat
gaactgcaacaaccgctggagcttaagccagagccagagccagagctggagtggttaaag
ccagagccagagctggagtcgttaaagccggagccaggcctggtgccagagctcgacctg
gacttagagtcactgctgaaggcagggctggatctgggcccagcactagagtctgtgctg
gagtccactctggaccctgtaatggagcccacactatgcacggtatcacaaacagtacca
cagccagaccaaggacctgtatcacagccagtgccagaaccagatttgccctgtgatctg
agacatttgaacactgaaccaatggaaatcttcagaaactgtataaagattgaagaaatc
atgccgaatggtgacccactgttggccggccagaacaccatggatgaggctttcgtctcc
cgccccagccacttctacactgatggatccttgatgccttctgacttctag

DBGET integrated database retrieval system