KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101029979
Entry
101029979         CDS       T04350                                 

Gene name
IL6ST
Definition
(RefSeq) interleukin-6 receptor subunit beta
  KO
K05060  interleukin 6 signal transducer
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04630  JAK-STAT signaling pathway
sbq04659  Th17 cell differentiation
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101029979 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101029979 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101029979 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101029979 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101029979 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101029979 (IL6ST)
   05203 Viral carcinogenesis
    101029979 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101029979 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101029979 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101029979 (IL6ST)
   04090 CD molecules [BR:sbq04090]
    101029979 (IL6ST)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IL6/12 receptor family
   101029979 (IL6ST)
CD molecules [BR:sbq04090]
 Proteins
  101029979 (IL6ST)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig EpoR_lig-bind IL6Ra-bind Pur_ac_phosph_N fn3_2
Other DBs
NCBI-GeneID: 101029979
NCBI-ProteinID: XP_003925890
UniProt: A0A2K6UU39
LinkDB
Position
Unknown
AA seq 919 aa
MLTLQTWLVQALFIFLTTESIGELLDPCGHISPESPVVQLHSNFTAVCVLKEKCMDYFHV
NANYIFWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITV
ISGLAPEKPENLTCIVNEGKKMMCQWDPGRETHLETNFTLKSEWATHKFPDCIAKRDTPT
SCTVDYSTVYFVNIEVWVEAENALGNVTSDHINFDPVYKVKPNPPHNLSVINSEELSSIL
KLTWTNPGIKSVITLKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKTDPSHTRGNRTVQLMWKTLPPFEAN
GKILDYEVTLTRWKSRLQNFYTVNDTKLTANLTSDHYVATLTARNLVGKSDAAVLTIPAC
DFQATRPVMDLKAFPKDNMLWVEWTTPRESVKKYVLEWCVLSDTSPCITDWQQEDGTVHR
TYLRGNLAESKCYVITVTPVYADGPGRPQSIKAYLKQAPPSKGPTVRTKKVGKNEAVLEW
DQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEG
GKDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPS
KSHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKI
NTEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQVPSVQVFSR
SESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSS
VNEEDFVRLKQQISDRISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVAMEAAIDE
GMPKSYLPQTVRQGGYMPQ
NT seq 2760 nt   +upstreamnt  +downstreamnt
atgttgacgttgcagacttggctagtgcaagccttgtttattttcctcaccactgaatct
ataggtgaacttctagatccatgtggtcatatcagtcctgaatctccagttgtacaactt
cattctaatttcactgcagtttgtgtgctaaaggaaaaatgtatggattattttcatgta
aatgcgaattacattttctggaaaacaaaccattttactattcctaaggaacaatatact
atcataaacagaacagcatccagtgtcacctttacagatatagcttcattaaatattcag
ctcacttgcaacattcttacatttggacagcttgaacagaatgtttatggaatcacagta
atttcaggcttggctccagaaaaacctgaaaatttgacttgcattgtgaatgagggaaag
aaaatgatgtgtcagtgggatcctggaagggaaacacacttggagacaaacttcacttta
aaatctgaatgggcaacacacaagtttcctgattgcatagcaaaacgtgacacccctacc
tcatgcactgttgattattctactgtgtattttgtcaacattgaagtctgggtagaagca
gagaatgcgcttgggaatgtcacatcagatcacatcaattttgatcctgtatataaagtg
aaacccaatccaccacataatttatcagtgatcaactcagaggaactgtctagtatctta
aaactgacgtggaccaacccaggtattaagagtgtaataacactaaaatataacattcaa
tataggaccaaagatgcctcaacttggagccagattcctcctgaagatacagcatccacc
cgatcttcattcactgtccaggaccttaagcctttcacagaatatgtatttaggattcgc
tgtatgaaggaagatggtaagggatactggagtgactggagtgaagaagcaagtgggatc
acctatgaagatagaccatctaaagcaccgagtttctggtataaaacagatccatcccat
actcgtggcaatagaactgtacaactcatgtggaagacattgcctccttttgaagccaat
ggaaaaatcttggattatgaagtgactctcacaagatggaaatcacgtttacaaaatttt
tacacagttaatgacacaaagctgacagcaaatcttacaagtgatcactatgtagcaacc
ctaacagcaagaaatcttgttggcaaatcagatgcagctgttttaactattcctgcctgt
gactttcaagctactcgccctgtaatggatcttaaagcattccccaaagataacatgctt
tgggtagaatggactactccaagggaatctgtaaagaaatatgtacttgagtggtgtgtg
ttatcagatacatcaccctgtatcacagactggcaacaagaagatggtaccgtgcatcgc
acctatttaagagggaacttagcagagagcaaatgctatgtgataacagttactccagta
tatgctgatggaccaggaaggcctcaatccataaaggcataccttaaacaagccccacct
tccaaaggacctactgttcggacaaaaaaagtagggaaaaatgaagcggtcttagagtgg
gaccaacttcctgttgatgttcagaatggatttatcagaaattacactatattttataga
accatcattggaaatgaaaccgctgtgaatgtggattcttcccacacagaatatacattg
tcctctttgactagtgacacattgtacatggttcgaatggcagcatacacagatgaaggt
gggaaggatggtccagaattcacttttactacaccaaagtttgctcaaggagaaattgaa
gccatagtcgtgcctgtttgcttagcattcctattgacaactcttctgggagtgttgttc
tgctttaataagcgagacctaattaaaaaacacatctggcctaatgttccagatccctca
aagagtcatattgcccagtggtcacctcacactcctccaaggcacaattttaattcaaaa
gatcaaatgtattcagatggcaatttcaccgatgtaagtgttgtggaaatagaagcgaat
gacaaaaagccttttccagaagatctgaaatcactggacctattcaaaaaggaaaaaatt
aataccgaaggacacagcagtggtattggggggtcttcatgcatgtcatcttctaggcca
agcatttctagcagtgatgaaaatgagtcttcacaaaacacttcgagtactgtccagtat
tctactgtggtacacagtggctacagacaccaagttccatcagtccaagtattctcaaga
tccgagtccacccagcccttgttagattcagaggagcggccagaagatcttcaattagta
gatcatgtagatggtggtgatggcattttgcccaggcaacagtacttcaaacagaactgc
agtcagcatgaatccagtccagatatttcacattttgaaaggtcaaagcaagtgtcatca
gtcaatgaggaagattttgttagacttaaacaacagatttcagatcgtatttcacaatcc
tgtggatctgggcaaatgaaaatgtttcaggaagtttctgcagcagatgcttttggtcca
gggactgagggacaagtagaaagatttgaaacagttgcgatggaggctgcaattgatgaa
ggaatgcctaaaagttacttaccacagactgtacggcaaggcggctacatgcctcagtga

DBGET integrated database retrieval system