KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030219
Entry
101030219         CDS       T04350                                 

Gene name
MAP2K6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6 isoform X1
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04015  Rap1 signaling pathway
sbq04218  Cellular senescence
sbq04380  Osteoclast differentiation
sbq04620  Toll-like receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04668  TNF signaling pathway
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04912  GnRH signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
sbq05014  Amyotrophic lateral sclerosis
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05145  Toxoplasmosis
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101030219 (MAP2K6)
   04015 Rap1 signaling pathway
    101030219 (MAP2K6)
   04668 TNF signaling pathway
    101030219 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101030219 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101030219 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    101030219 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101030219 (MAP2K6)
   04935 Growth hormone synthesis, secretion and action
    101030219 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101030219 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101030219 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101030219 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101030219 (MAP2K6)
   05022 Pathways of neurodegeneration - multiple diseases
    101030219 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101030219 (MAP2K6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101030219 (MAP2K6)
   05135 Yersinia infection
    101030219 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101030219 (MAP2K6)
   05161 Hepatitis B
    101030219 (MAP2K6)
   05163 Human cytomegalovirus infection
    101030219 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101030219 (MAP2K6)
   05169 Epstein-Barr virus infection
    101030219 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101030219 (MAP2K6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101030219 (MAP2K6)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101030219 (MAP2K6)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: STE group
  STE7 family
   101030219 (MAP2K6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal DUF4344 Choline_kinase APH
Other DBs
NCBI-GeneID: 101030219
NCBI-ProteinID: XP_003931835
UniProt: A0A2K6S0L2
LinkDB
Position
Unknown
AA seq 334 aa
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKATDVASFVKLILGD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtctcagtcgaaaggtaagaagcgaaaccctggccttaaaattccaaaagaagcattt
gaacaacctcagaccagttccacgccacctcgagatttagactccaaggcttgcatttct
attggaaatcagaattttgaggtgaaggcagatgacctggagcctataatggaactggga
cgaggtgcatacggggtggtggagaaaatgcggcacgtgcccagtgagcagatcatggca
gttaagcggatccgagccacagtaaatagccaggaacagaaaaggctactgatggatttg
gatatttccatgaggacggtggactgtccattcaccgtcaccttttatggcgcactcttt
cgggagggtgatgtgtggatctgcatggagcttatggatacatcactagataaattctac
aaacaagttattgataaaggccagacaattccagaggacatcttagggaaaatagcagtt
tctattgtaaaagcattagaacatttacacagtaagctgtctgtcattcatagagacgtc
aagccttctaacgtactcattaatgctcttggtcaagtgaagatgtgcgattttggaatc
agtggctacttggtggactctgtagctaaaacaattgatgcaggttgcaagccatacatg
gcccctgaaagaataaacccagagctcaaccagaagggatacagtgtgaagtctgacatt
tggagtctgggcatcacgatgattgaattggccatccttcggtttccctatgattcatgg
ggaactccatttcagcagctcaaacaggtggtagaggagccatcgccacaactcccagca
gacaagttctctgcagagtttgttgactttacctcacagtgcttaaagaagaattccaaa
gaacggcctacatacccagagctaatgcaacatccatttttcaccctacatgaatccaaa
gcaacagatgtggcatcttttgtaaaactgattcttggagactaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034633
Entry
101034633         CDS       T04350                                 

Gene name
MAP2K3
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3 isoform X2
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04015  Rap1 signaling pathway
sbq04218  Cellular senescence
sbq04620  Toll-like receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04668  TNF signaling pathway
sbq04714  Thermogenesis
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04912  GnRH signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
sbq05014  Amyotrophic lateral sclerosis
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05145  Toxoplasmosis
sbq05161  Hepatitis B
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101034633 (MAP2K3)
   04015 Rap1 signaling pathway
    101034633 (MAP2K3)
   04668 TNF signaling pathway
    101034633 (MAP2K3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101034633 (MAP2K3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101034633 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    101034633 (MAP2K3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101034633 (MAP2K3)
   04935 Growth hormone synthesis, secretion and action
    101034633 (MAP2K3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101034633 (MAP2K3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101034633 (MAP2K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101034633 (MAP2K3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101034633 (MAP2K3)
   05022 Pathways of neurodegeneration - multiple diseases
    101034633 (MAP2K3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101034633 (MAP2K3)
   05135 Yersinia infection
    101034633 (MAP2K3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101034633 (MAP2K3)
   05161 Hepatitis B
    101034633 (MAP2K3)
   05169 Epstein-Barr virus infection
    101034633 (MAP2K3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101034633 (MAP2K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101034633 (MAP2K3)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101034633 (MAP2K3)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: STE group
  STE7 family
   101034633 (MAP2K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase DUF4344
Other DBs
NCBI-GeneID: 101034633
NCBI-ProteinID: XP_003929366
UniProt: A0A2K6V164
LinkDB
Position
Unknown
AA seq 347 aa
MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLEKGMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMAHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagtcgcccgcctcgagccaacccgccagcatgccccagtccaaaggaaaatccaag
aggaagaaggatctgaggatatcctgcatgtccaagccgcccgcacccaaccccacaccc
ccccggaacctggactcccggaccttcatcaccattggagacagaaactttgaggtggag
gccgatgacttggtgaccatctcagaactggggcgtggagcctatggggtggtggagaag
gtgcggcatgcccagagtggcaccatcatggccgtgaagcggatccgggccaccgtgaac
tcacaggagcagaagcggctgctcatggacctggacatcaacatgcgcacggtcgattgc
ttctacactgtcaccttctatggcgcactattccgagagggagatgtgtggatctgcatg
gagctcatggacacatccctggacaagttctaccggaaggtgctggagaaaggcatgaca
attccagaggacatcctcggggagattgctgtgtctatcgtgcgggccctggagcatctg
cacagcaagctgtcggtgatccacagagatgtgaagccctccaatgtgcttatcaacaag
gagggccacgtgaagatgtgtgactttggcatcagtggctacttggtggactctgtggct
aagacgatggatgccggctgcaagccctacatggcccctgagaggatcaacccggagctg
aaccagaagggctacaatgtcaagtctgatgtctggagcctgggcatcaccatgattgag
atggccatcctacgattcccttacgagtcctgggggaccccgtttcagcagctgaagcag
gtggtggaggagccgtccccccagctcccagctgaccgtttctcccccgagtttgtggac
ttcactgcgcagtgcctgaggaagaaccccgcagagcggatgagctacctggagctgatg
gcgcaccccttcttcactttgcacaaaaccaagaagacggacattgctgccttcgtgaag
gagatcttgggagaagactcatag

DBGET integrated database retrieval system