KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030350
Entry
101030350         CDS       T04350                                 

Gene name
PAK3
Definition
(RefSeq) serine/threonine-protein kinase PAK 3 isoform X1
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04360  Axon guidance
sbq04510  Focal adhesion
sbq04660  T cell receptor signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq05132  Salmonella infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101030350 (PAK3)
   04014 Ras signaling pathway
    101030350 (PAK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101030350 (PAK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101030350 (PAK3)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101030350 (PAK3)
  09158 Development and regeneration
   04360 Axon guidance
    101030350 (PAK3)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101030350 (PAK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101030350 (PAK3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101030350 (PAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101030350 (PAK3)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101030350 (PAK3)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: STE group
  STE20 family
   101030350 (PAK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like Spt5_N DSHCT APH Ribosomal_60s Kdo
Other DBs
NCBI-GeneID: 101030350
NCBI-ProteinID: XP_010344645
LinkDB
Position
Unknown
AA seq 547 aa
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVL
DVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEE
EEDDNEPPPVIAPRPEHTKSIYTRSVVESIASPAAPNKEVTPPSAENANSSTLYRNTDRQ
RKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMN
LQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMD
EGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRS
TMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTP
ELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQVLLAGGNSLHNYAIISVAFATLMLY
WSKPLCL
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgtctgacggtctggataatgaagagaaacccccagctcccccactgaggatgaatagt
aacaaccgggattcttcagcactcaaccacagctccaaaccacttcccatggcccctgaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaggagaaagagcgtccagagatctctcttccttcagactttgagcatacgatt
catgtggggtttgatgcagtcaccggggaattcactggaattcctgagcaatgggcacga
ttactccaaacctccaacataacaaaattagaacagaagaagaacccacaagctgttcta
gatgttctcaaattctatgattccaaagaaacagtcaacaaccagaaatacatgagcttt
acatcaggagataaaagtgcacatggatacatagcagcccatccttcgagtacaaaaaca
gcatctgaacctccattggcccctcctgtgtctgaagaagaagatgaagaagaggaggaa
gaagaagatgacaatgagcccccaccagttattgcaccaagaccagagcatacaaaatca
atctacactcgttctgtggttgaatccattgcttcaccagcagcaccaaataaagaggtc
acaccaccctctgctgagaatgccaattccagtactttgtacagaaacacagatcggcaa
agaaaaaaatccaagatgacagatgaggagatcttagagaaactaagaagcattgtgagt
gttggggacccaaagaaaaaatacacaagatttgaaaaaattggtcaaggggcatcaggt
actgtttatacagcactagacattgcaacaggacaagaggtggccataaagcagatgaac
cttcaacagcaacccaaaaaggaattaattattaatgaaattctggtcatgagggaaaat
aagaaccctaatattgttaattatttagatagctacttagtgggtgatgaactatgggta
gtcatggaatacttggctggtggctctctgactgatgtggtcacggagacctgtatggat
gaaggacagatagcagctgtctgcagagagtgcctgcaagctttggatttcttgcactca
aaccaggtgatccatagagatataaagagtgacaatattcttctcgggatggatggctct
gttaaattgactgactttgggttctgtgcccagatcactcctgagcaaagtaaacgaagc
actatggtgggaaccccatactggatggcacctgaggtggtgactcgaaaagcttatggt
ccaaaagttgatatctggtctctgggaattatggcaattgaaatggtggaaggtgaaccc
ccttaccttaatgaaaatccactcagggcattatatctgatagccactaatggaacccca
gagctccagaatcctgagagactgtcggctgtattccgtgactttttaaatcgctgtctt
gagatggatgtggataggcgaggatctgccaaggagcttttgcaggtgctcttggccgga
ggtaattctctacataactatgcaattatttccgtggcatttgctactctaatgctttac
tggtcaaagcccctttgcttgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030928
Entry
101030928         CDS       T04350                                 

Gene name
PAK4
Definition
(RefSeq) serine/threonine-protein kinase PAK 4
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04360  Axon guidance
sbq04510  Focal adhesion
sbq04660  T cell receptor signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq05170  Human immunodeficiency virus 1 infection
sbq05206  MicroRNAs in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101030928 (PAK4)
   04014 Ras signaling pathway
    101030928 (PAK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101030928 (PAK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101030928 (PAK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101030928 (PAK4)
  09158 Development and regeneration
   04360 Axon guidance
    101030928 (PAK4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101030928 (PAK4)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101030928 (PAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101030928 (PAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101030928 (PAK4)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101030928 (PAK4)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: STE group
  STE20 family
   101030928 (PAK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo KIND hnRNP_Q_AcD
Other DBs
NCBI-GeneID: 101030928
NCBI-ProteinID: XP_010329264
UniProt: A0A2K6U8R0
LinkDB
Position
Unknown
AA seq 594 aa
MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLGEFENMSVTRSNSLRRDSPPPPPARACQENGIPE
EPAATARAVPGKAGSRGRIAGHSEAGGGSGDRRRAGPEKRPKSSREGSGGPQESSRDKRP
LSGPDVGTPQPAGLASGAKLAAGRPFNTYPRADTDHPSRGAQGEPHDVAPNGPSAGGLAV
PQSSSSSRPPARARGAPSPGVLGPHASEPQLAPPARAPAAPTAPAVPGPPGPRSPQREPQ
RVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQ
QRRELLFNEVVIMRNYEHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQI
AAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVG
TPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKN
LHKVSPSLKGFLDRLLVRDPTQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgtttgggaagaggaagaagcgggtagagatctccgcgccatccaacttcgagcaccgc
gtgcacacgggcttcgaccagcacgagcagaagttcaccgggctgccccgccagtggcag
agcctgatcgaggagtcggctcgccggcccaagcccctcatcgaccctgcctgcatcacc
tccatccagcccggggcccccaagaccattgtgcggggcagcaaaggtgccaaggatggg
gccctcacgctgctgctgggcgagtttgagaacatgtcggtgacacgctccaactccctg
cggagagacagcccgccgccgccgcccgcccgtgcctgccaggaaaatgggataccggag
gagccggccgccacagccagagcggtcccggggaaggcagggagtcgaggccggatcgcc
ggtcacagcgaggcgggtggcggcagtggtgacaggcgacgggcggggccagagaagagg
cccaagtcttccagggagggctcagggggcccccaggagtcctcccgggacaaacgcccc
ctctctgggcctgacgtcggcaccccacagcctgctggtctggccagtggggcgaaactg
gcagctggccggccctttaacacctacccgagggctgacaccgaccacccatcccggggt
gcccagggggagcctcacgacgtggcccctaacgggccatcagcgggtggcctggccgtc
ccccagtcctcctcttcctcccggcctcccgcccgagcccgaggcgcccccagccctgga
gtgctgggcccccacgcctcggagccccagctggcccctccagcccgcgcccctgccgcc
cccaccgcccctgctgttcccgggccccccggcccccgctcgccacagcgggagccacag
cgcgtatcccacgagcagttccgggctgccctgcagctggtggtggacccgggtgacccc
cgatcctacctggacaacttcatcaagattggcgagggctccaccggcatcgtgtgcatc
gccaccgtgcgcagctcgggcaagttggtggccgtcaagaagatggacctgcgcaagcag
cagaggcgcgagctgctcttcaacgaggtggtgatcatgcggaactatgagcatgagaac
gtggtggagatgtacaacagctacctggtgggggacgagctctgggtggtcatggagttc
ctggaaggaggcgccctcaccgacattgtcacccacaccaggatgaatgaggagcagatc
gcagccgtgtgcctggcagtgctgcaggccctgtcggtgctccacgcccagggcgtcatc
caccgggacatcaagagcgactcgatcctgctgacccatgacggcagggtgaagctgtca
gacttcgggttctgcgcccaggtgagcaaggaagtgccccggaggaagtcgctggtcggc
acgccctactggatggccccagagctcatctcccgccttccctacgggccagaggtggat
atctggtcgctggggataatggtgatcgagatggtggacggagagcccccctacttcaac
gagccacccctcaaagccatgaagatgattcgggacaacctgccaccccgactgaagaac
ctacacaaggtgtcgccttccctgaagggcttcctggaccgcctgctggtgcgggacccc
acccagcgggccacggctgccgagctgctgaagcacccattcctggccaaggcgggaccg
cccgccagcatcgtgcccctcatgcgccagaaccgcaccagatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035351
Entry
101035351         CDS       T04350                                 

Gene name
PAK2
Definition
(RefSeq) serine/threonine-protein kinase PAK 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04360  Axon guidance
sbq04510  Focal adhesion
sbq04660  T cell receptor signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq05170  Human immunodeficiency virus 1 infection
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101035351 (PAK2)
   04012 ErbB signaling pathway
    101035351 (PAK2)
   04014 Ras signaling pathway
    101035351 (PAK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101035351 (PAK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101035351 (PAK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101035351 (PAK2)
  09158 Development and regeneration
   04360 Axon guidance
    101035351 (PAK2)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101035351 (PAK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101035351 (PAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101035351 (PAK2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101035351 (PAK2)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: STE group
  STE20 family
   101035351 (PAK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 101035351
NCBI-ProteinID: XP_003926249
UniProt: A0A2K6UTV6
LinkDB
Position
Unknown
AA seq 525 aa
MSDNGELEDKPPAPPVRMSSTIFSSGGKDPLSANHSLKPLPSVPEESKKPRNKIISIFSG
TEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKN
PQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGSETSAVVTEEDDDDEETA
PPVIAPRPDHTKSIYTRSVIDPVPAPVGDSNVDGGAKSSDKQKKKTKMTDEEIMEKLRTI
VSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMK
ELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFL
HANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA
YGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNR
CLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcctccagcacctcctgtgcgaatgagcagt
accatttttagcagcggaggcaaagaccctttgtcagccaatcacagtttgaaacctttg
ccctctgttccggaggagtctaaaaagcccaggaataaaatcatctccatattctcaggc
acagagaaaggaagtaaaaagaaagaaaaggaacggccagaaatttctcctccatctgat
tttgaacacactatccatgttggctttgatgctgttactggagaattcactggcatgcca
gaacagtgggctcgattactacagacctccaatatcaccaaactagagcaaaagaagaat
cctcaggctgtactggatgtcttaaagttctacgactccaacacagtgaagcagaaatac
ctgagctttactcctcctgagaaagatggcttcccttctggaacaccagcattgaatgcc
aagggatcagaaacatcagcagtagtgacagaggaagatgatgatgatgaagaaactgct
cctcctgttattgccccacgaccagatcatacaaaatcaatttatacacggtctgtaatt
gaccctgttcctgcaccagttggtgattcaaatgttgatggtggtgccaagtcttcagac
aaacagaaaaagaagactaagatgacagatgaagagattatggagaaattaagaactatt
gtgagcataggcgaccctaagaaaaaatatacaagatatgaaaaaattggacaaggggct
tctggtacagttttcactgctactgacgtcgcattgggacaggaggttgctatcaaacag
attaatttacagaaacagccaaagaaggaattgattattaatgagattctggtgatgaaa
gaattaaaaaatcccaacatagttaacttcttggacagttacctggtaggagatgaattg
tttgtggtaatggagtaccttgctggtgggtcacttactgatgttgtaacagaaacctgc
atggatgaagcacagattgctgccgtatgcagagagtgtttacaggcattggagtttttg
catgctaatcaagtgatccacagagatatcaaaagtgacaatgtacttttgggaatggaa
ggatcagttaaacttactgactttggtttctgtgcccagatcacccctgagcagagcaaa
cgcagtaccatggtcggaacaccatactggatggcaccagaggtggttactcggaaagct
tacggccctaaagttgacatatggtctctgggtatcatggctattgagatggtagaagga
gagcctccatacctcaatgaaaatcccttgagggccttgtacctaatagcaactaatgga
acgccagaacttcagaatccagagaaactttccccaatatttcgggatttcttaaatcga
tgtttggaaatggatgtggaaaaaaggggttcagccaaagaattattacagcatcctttc
ctcaaactggccaaaccattatctagcttgacaccactgatcatggcagctaaagaagca
atgaagagtaaccgttaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042666
Entry
101042666         CDS       T04350                                 

Gene name
PAK1
Definition
(RefSeq) serine/threonine-protein kinase PAK 1 isoform X1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04360  Axon guidance
sbq04392  Hippo signaling pathway - multiple species
sbq04510  Focal adhesion
sbq04625  C-type lectin receptor signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04660  T cell receptor signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04810  Regulation of actin cytoskeleton
sbq05132  Salmonella infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05205  Proteoglycans in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101042666 (PAK1)
   04012 ErbB signaling pathway
    101042666 (PAK1)
   04014 Ras signaling pathway
    101042666 (PAK1)
   04392 Hippo signaling pathway - multiple species
    101042666 (PAK1)
   04024 cAMP signaling pathway
    101042666 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101042666 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101042666 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101042666 (PAK1)
   04650 Natural killer cell mediated cytotoxicity
    101042666 (PAK1)
   04660 T cell receptor signaling pathway
    101042666 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    101042666 (PAK1)
   04062 Chemokine signaling pathway
    101042666 (PAK1)
  09158 Development and regeneration
   04360 Axon guidance
    101042666 (PAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101042666 (PAK1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101042666 (PAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101042666 (PAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101042666 (PAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101042666 (PAK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101042666 (PAK1)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101042666 (PAK1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101042666 (PAK1)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: STE group
  STE20 family
   101042666 (PAK1)
Membrane trafficking [BR:sbq04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101042666 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    101042666 (PAK1)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101042666 (PAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Other DBs
NCBI-GeneID: 101042666
NCBI-ProteinID: XP_003943013
UniProt: A0A2K6V2G6
LinkDB
Position
Unknown
AA seq 546 aa
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNT
EKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIK
QMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTET
CMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQS
KRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATN
GTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKE
ATKNNH
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgtcaaataacggcctagacattcaagacaaacccccagcccctccgatgagaaatacc
agcaccatgattggagccggcagcaaagatgctggaaccctaaaccatggttctaaacct
ctgcctccaaacccagaagagaagaaaaagaaggaccgattttacagatccatcttacct
ggagataaaacaaataaaaagaaagagaaagagaggccagagatttctcttccttcagat
tttgaacacacaattcatgtcggttttgatgctgtcacaggggagtttacgggaatgcca
gagcagtgggcccgcttgcttcagacatcaaatatcactaagtcggagcagaagaaaaac
ccgcaggctgttctggatgtgttggagttttacaactcaaagaagacatccaacagccag
aaatacatgagctttacagataagtcagctgaggattataattcttctaacgctttgaat
gtaaaggctgtgtctgagactcctgcagtgccaccagtttcagaagatgaggatgatgat
gatgatgatgatgctaccccaccaccagtgattgctccacgcccagaacacacaaaatct
gtatacacacggtctgtgattgaaccacttcctgtcactccaactcgggacgtggctaca
tctcccatttcacctactgaaaataacaccactccaccagatgctttgacccggaatact
gagaagcagaagaagaagcctaaaatgtctgatgaggagatcttggagaaattacgaagc
atagtgagtgtgggcgatcctaagaagaaatatacacggtttgagaagattggacaaggt
gcttcaggcaccgtgtacactgcaatggatgtggccacaggacaggaggtggccattaag
cagatgaatcttcagcagcagcccaagaaagagctgataattaatgagatcctggtcatg
agggaaaacaagaatccaaacattgtgaattacttggacagttaccttgtgggagatgag
ctgtgggttgttatggaatacttggctggaggctccttgacagacgtggtgacagaaacc
tgcatggatgaaggccagattgccgctgtgtgccgtgagtgtctgcaggctctggagttt
ctgcattcgaaccaggtcattcacagagacatcaaaagcgacaatattctgttgggaatg
gatggctctgtcaagctaactgattttggattctgcgcacagataaccccagagcagagc
aaacggagcaccatggtaggaaccccatactggatggcaccagaggttgtgacacgaaag
gcctatgggcccaaggttgacatctggtccctgggcatcatggccattgaaatgattgaa
ggagagcctccatacctcaatgaaaaccctctgagagccttgtacctcattgccaccaat
gggaccccggaacttcagaacccagagaagctgtcagctatcttccgggactttctgaac
cgctgtcttgagatggatgtggagaagagaggttcagctaaagagctgctgcagcatcaa
ttcctgaagattgccaagcccctctccagcctcactccactgattgctgcagcaaaggag
gcaacaaagaacaatcactaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045496
Entry
101045496         CDS       T04350                                 

Gene name
PAK7
Definition
(RefSeq) serine/threonine-protein kinase PAK 7
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04360  Axon guidance
sbq04510  Focal adhesion
sbq04660  T cell receptor signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq05170  Human immunodeficiency virus 1 infection
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101045496 (PAK7)
   04014 Ras signaling pathway
    101045496 (PAK7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101045496 (PAK7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101045496 (PAK7)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101045496 (PAK7)
  09158 Development and regeneration
   04360 Axon guidance
    101045496 (PAK7)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101045496 (PAK7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101045496 (PAK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101045496 (PAK7)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101045496 (PAK7)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: STE group
  STE20 family
   101045496 (PAK7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 101045496
NCBI-ProteinID: XP_003933255
UniProt: A0A2K6U2R7
LinkDB
Position
Unknown
AA seq 719 aa
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHV
EENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEA
YYSEMKPFKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSHLDYSFQFTPSRTA
GTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFG
ASAFKTHPQGHSYSSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS
QSKAGYSSSSHQYPAGYHKATLYHHPSLQSSSQYISTASYLSSLSLSSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgtttgggaagaaaaagaaaaagattgaaatatctggcccatccaactttgaacacagg
gttcatactgggtttgatccacaagagcagaagtttaccggccttccgcagcagtggcac
agcctgttagcagatacggccaacaggccaaagcctatggtggacccttcatgtatcaca
cctatacagctggctcctatgaagacaatcgttagaggaaacaaaccctgcaaggaaacc
tccatcaatggcctgctagaggatttcgacaacatctcggtgactcgctcaaactctcta
aggaaagaaagcccacccaccccagatcagggagcctccagccacggtccaggccacgtg
gaagaaaatggcttcatcaccttctctcagtattccagcgaatccgatactactgctgac
tacacaactgaaaagtacagagagaagagtctctatggagacgatctggatccgtattat
agaggcagccatgcagccaagcaaaatgggcatgtaatgaaaatgaagcatggggaggcc
tactattctgagatgaagccttttaaatctgattttgccagattttctgcagattatcac
tcacatttggactcactgagcaaaccaagtgagtatagtgacctcaagtgggagtatcag
agagcctcaagtagctcccatctggattattcattccaattcacaccttctagaactgca
gggaccagcgggtgctccaaggagagcctggcctacagtgaaagtgaatggggacccagc
ctggatgactatgacaggaggccaaagtcatcctacctgaatcagacgagccctcagccc
accatgcggcagaggtccaggtcaggctcggggctccaggaaccgatgatgccatttgga
gcaagtgcatttaaaacccatccccaaggacactcctacagctcctacacctaccctcgc
ttgtccgagcccacaatgtgcattccaaaggtggattacgatcgggcacagatggtcctc
agccctccactgtcagggtctgacacctaccccaggggccctgccaaactacctcaaagt
caaagcaaagcaggctattcctcaagcagccaccagtacccggctgggtaccacaaagcc
accttgtaccaccacccttccctgcagagcagttcgcagtacatctccaccgcttcctac
ctgagctccctcagcctctcatccagcacctacccgccgcccagctggggctcctcctct
gaccagcagccctccagggtgtcccatgaacagtttcgggcagccctgcagctggtggtc
agcccaggagaccccagggaatacttggacaacttcatcaaaatcggggaaggctcaacc
ggcatcgtgtgcatcgccaccgagaaacacacagggaaacaagttgcagtgaagaaaatg
gacctccggaagcaacagagacgggaactgctttttaatgaggtcgtgatcatgcgggat
taccaccatgacaacgtggttgacatgtacaacagctaccttgttggtgatgagctctgg
gtggtcatggagtttctagaaggtggtgccttgacagacattgtgactcacaccagaatg
aatgaagaacagatagctactgtctgcctgtcagttctgagagctctctcctaccttcat
aaccaaggagtgattcacagggacataaaaagtgactccatcctcctgacaagcgatggc
cggataaagttatctgattttggtttctgtgctcaagtttccaaagaggtgccaaagagg
aaatcattggttggcactccctactggatggcccctgaggtgatttctaggctaccttat
gggacagaggtggacatctggtccctcgggatcatggtgattgaaatgatcgatggcgag
cccccttacttcaatgagccccctctccaggcaatgcggaggatcagggacagtttacct
ccaagagtgaaggacctacacaaggtttcttcagtgctccggggatttctagacctgatg
ttggtgagggagccttctcagagagcaacagcccaggaactccttggacatccattctta
aaactagcaggtccaccatcttgcattgtccccctcatgagacaatacagacatcactga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053141
Entry
101053141         CDS       T04350                                 

Gene name
PAK6
Definition
(RefSeq) serine/threonine-protein kinase PAK 6 isoform X1
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04360  Axon guidance
sbq04510  Focal adhesion
sbq04660  T cell receptor signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq05170  Human immunodeficiency virus 1 infection
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101053141 (PAK6)
   04014 Ras signaling pathway
    101053141 (PAK6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101053141 (PAK6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101053141 (PAK6)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101053141 (PAK6)
  09158 Development and regeneration
   04360 Axon guidance
    101053141 (PAK6)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101053141 (PAK6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101053141 (PAK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101053141 (PAK6)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101053141 (PAK6)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: STE group
  STE20 family
   101053141 (PAK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 101053141
NCBI-ProteinID: XP_010344530
UniProt: A0A2K6TQG4
LinkDB
Position
Unknown
AA seq 706 aa
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGNAVPVDGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDE
HWATDPDMYLQSPQSERTDPHGLYLSCNGGTPAGHQQMPRPEPQSPRVLSNGLAAKAQSL
GPAEFQGASQRCLQLGACLQSSPPGASPPTATSRHGMKAAKHGSEEARPQSCLVGSATSR
PGGEGSPSPKTQESSLKRRLFRSMFLSTAATAPPSSSKPGPPPQSKPNSSFRPLQKETPP
SLVAKAQSLPSDQPVGTFSPLTTSDTSSPQKSLRTAPATGPLPGRSSPAGSPRTRHAQIS
TSNLYLPQDPTVAKGTLAGEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGI
VCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHVNVVEMYKSYLVGEELWVL
MEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRV
KLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPP
YFSDSPVQAMKRLRDCPPPKLKNSHKKPQGLGSWKRLLFLHTKPAPGCGAASPHKLSCAL
QQVSHGGGRRVAAPQALVGSPGMPMSRESQDTSSPCCPGRNPEKLH
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgttccgcaagaaaaagaagaaacgccctgagatctcagccccacagaacttccagcac
cgtgtccacacctccttcgaccccaaagaaggcaagtttgtgggcctccccccacaatgg
cagaacattctggacacactgcggcgccccaagcctgtggtggacccttcgcgaatcacg
cgggtgcagctccaacccatgaagacagtggtgcgcggcaacgcggtgcctgtggacggc
tacatctcgggactgctcaatgacatccagaagctgtcagtcatcagctccaacaccctg
cgtggccgcagccccaccagccggcggcgggcacagtccctggggctgctgggggatgag
cactgggccaccgatccagacatgtacctccagagccctcaatctgagcgcactgacccc
catggcctctacctcagctgcaacgggggcacaccagcaggccaccagcagatgccacgg
cccgagccacagagcccacgggtcctttccaatgggctggctgcaaaggctcagtctctg
ggacccgctgagttccagggcgcttcgcagcgctgtctgcagctgggtgcctgcctgcag
agctccccaccaggagcctcgccccccacagccaccagtaggcatggaatgaaggctgcc
aagcatggctctgaggaggcccggccacagtcctgcttggtgggctcagccacgagcagg
ccaggtggggaaggcagccctagccctaagacccaggagagcagcctgaagcgcaggcta
ttccgaagcatgttcctgtccactgctgccacagcccctccaagcagcagcaagccaggc
cctccaccacagagcaagcccaactcgtctttccgaccgctgcagaaagaaaccccccca
agcctggtggccaaggcccagtccttgccctcggatcagccggtggggaccttcagccct
ctcaccacttcggataccagcagcccccagaagtccctccgcacagccccagccacaggc
ccacttccaggccggtcttccccagcgggttccccccgtacccggcacgcccagatcagc
accagcaacctgtacctgccccaggaccccactgtcgccaagggcaccctggctggtgag
gacacaggtgttgtgacgcatgagcagttcaaggcagcgctcaggatggtggtggaccag
ggcgacccccggctgctgctggacagctacgtgaagattggcgagggctccaccggcatc
gtctgcttggcccgggagaagcactcgggccgtcaggtggccgtcaagatgatggacctc
aggaagcagcagcgcagggagctgctcttcaacgaggtggtgatcatgcgggactaccag
cacgtcaacgtggtggagatgtacaagagctacctggtgggcgaggagctgtgggtgctc
atggagttcctgcagggaggagccctcacagacatcgtctcccaagtcaggctgaatgaa
gagcagatcgccactgtatgtgaggctgtgctgcaggccctggcctacctgcatgcccag
ggcgtcatccaccgggacatcaagagcgactccatcctgctgaccctcgatggcagggtg
aagctctcggacttcggattctgtgctcagatcagcaaagacgtccctaagaggaagtcc
ctggtgggaaccccctactggatggctcctgaagtgatctccaggtctttgtatgccact
gaggtggatatctggtctctgggcatcatggtgattgagatggtggatggggagccaccc
tacttcagcgactccccagtgcaagccatgaagaggctccgggactgccccccgcccaag
ctgaaaaactctcacaagaagccacagggtctgggctcctggaaaaggctcctctttctc
cacacaaaacccgcacctgggtgtggagccgcatctccgcataaactctcatgtgcactc
cagcaagtctcccatggcggcggcaggagggtcgctgctccgcaggcactggtcggaagc
ccagggatgcccatgagcagggaaagccaggacaccagcagtccctgctgtcccgggagg
aatccggagaagcttcactga

DBGET integrated database retrieval system