KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030426
Entry
101030426         CDS       T04350                                 

Gene name
CTNNA3
Definition
(RefSeq) catenin alpha-3 isoform X1
  KO
K05691  catenin alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04390  Hippo signaling pathway
sbq04520  Adherens junction
sbq04670  Leukocyte transendothelial migration
sbq05100  Bacterial invasion of epithelial cells
sbq05200  Pathways in cancer
sbq05213  Endometrial cancer
sbq05226  Gastric cancer
sbq05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101030426 (CTNNA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101030426 (CTNNA3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101030426 (CTNNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101030426 (CTNNA3)
  09162 Cancer: specific types
   05226 Gastric cancer
    101030426 (CTNNA3)
   05213 Endometrial cancer
    101030426 (CTNNA3)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101030426 (CTNNA3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101030426 (CTNNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sbq04812]
    101030426 (CTNNA3)
Cytoskeleton proteins [BR:sbq04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     101030426 (CTNNA3)
SSDB
Motif
Pfam: Vinculin AAA_32
Other DBs
NCBI-GeneID: 101030426
NCBI-ProteinID: XP_003928733
UniProt: A0A2K6U060
LinkDB
Position
Unknown
AA seq 895 aa
MSAETPVTLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSNRKKGRSKRASVLLA
SVEEATWNLLDKGEKIAREATVLKNELTASLEEVRKESEALKISAERFTDDPCFLPKREA
VVQAARALLAAVTRLLILADMVDVMCLLQHVSAFQRTFESLKNVANKSDLQKTYQKLGKE
LENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICSACLEHSDVASLKASKDT
VCEEIQNALNVISNASQGIQNMTALPEPQTATLGSALDELESLIVLNPLTVTEEEIRPSL
EKRLEAIISGAALLADSSCTRDFHRERIIAECNAIRQALQDLLSEYMNNTGKKERSNTLN
AALDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIFHE
HTSRLVEVANLACSMSTNEDGIKIVKTAASHLETLCPQIINAALALAARPKSQVVKNTME
MYKRTWENHIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDPDNLDRAAGAI
RGRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKNSLNV
LDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEDHEVRSHTSVQTEGKTDRA
KMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKNMCMIMMEMTDFTR
GKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLK
ICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAG
PRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKKIHPVQVMSEFRGRQVY
NT seq 2688 nt   +upstreamnt  +downstreamnt
atgtcagctgaaacaccagtcactctgaatattgatcctcaggatctgcaggtccaaaca
ttcactgtagagaagctgctggagcctctcataatccaggttaccacacttgtaaactgt
ccccagaacccttccaacaggaaaaaaggacgttcaaaaagagccagtgttcttctagct
tctgtggaggaagcaacttggaatttattagacaagggagagaagattgcccgggaagct
acagttctaaagaatgagcttactgcttcacttgaggaagttcgcaaagaaagtgaagct
ctgaaaatatcagctgagagattcacagatgacccctgttttctcccaaaaagggaggct
gtggttcaagccgcccgtgccttgctggctgcagtgacgagactccttattcttgcggac
atggttgatgtcatgtgcctcttgcagcatgtgtcagcttttcaaaggacatttgagtct
ctcaaaaatgttgccaacaaatctgacctccagaaaacctaccagaagcttgggaaggag
ttggaaaatttggattatttagccttcaaacgtcagcaggacttaaaatctccaaatcag
agggatgaaattgcaggagctcgagcctcattgaaggagaactctcccctcttgcattca
atttgttcagcttgtttggagcattctgatgttgcttcactcaaagcaagcaaggacaca
gtttgtgaagaaattcagaatgctctcaatgtaatttcaaatgcttcacaaggcatccag
aatatgacagccctaccagaacctcagacagcaaccctgggaagtgcccttgatgagctg
gagagtttaattgtcctgaatccactcacagtgactgaggaggaaataagaccatccctg
gagaaacggcttgaagccattatcagtggggctgctctgctggcagactcttcgtgcacg
agggacttccaccgggagcggatcatcgctgaatgcaacgccattcgccaggctcttcag
gatctgctttcggagtacatgaacaacactggaaaaaaagaaaggagtaataccctgaat
gctgctttagacaacatgtgtaagaagacaagggaccttcgcagacagctccgcaaggct
attatagatcatgtgtcagactctttcttggatacaacagtcccacttttggttctcatt
gaagctgctaagaatggccgggaaaaggaaataaaagaatatgctgcgatatttcatgaa
cacaccagcaggcttgtagaggtggcaaatcttgcttgttccatgtcaacaaatgaagat
ggaattaaaatcgtcaaaactgcagccagtcatttggaaaccttatgtccacagattatt
aatgctgcgcttgctttggctgcaagacccaaaagtcaggtggtaaaaaacaccatggaa
atgtacaaacgtacatgggagaatcatatacatgtcctcactgaagctgtagatgacatt
acaagcatcgatgacttccttgctgtatctgaaagccatatcctggaagatgtcaacaag
tgtatcatagcattaagagaccaggatcctgataatttagaccgtgccgcgggtgctatc
agaggccgggcagcaagagttgctcacatcgtcacgggtgaaatggacagttacgagcct
ggggcttatactgaaggtgtaatgagaaatgttaacttccttacaagtactgtaattcct
gaatttgtaacacaagtgaatgttgccttggaagccttaagcaagaactcattgaatgtg
ttggatgataatcaatttgtggacatctcaaagaaaatctatgatactattcatgatatc
agatgttcagtcatgatgattcggaccccagaggaactggaggatgtttctgaccttgaa
gaggatcacgaggttcgcagtcacaccagtgttcagacagaagggaaaactgacagggct
aaaatgactcaactgcctgaggcagaaaaggaaaagattgctgagcaagttgctgatttc
aagaaagtaaagagtaagctggatgctgagattgagatatgggatgatacaagcaacgac
atcattgttctggccaagaacatgtgtatgatcatgatggagatgacagacttcaccagg
ggcaaaggaccactaaagcatacaactgatgtgatctatgcagcaaaaatgatatcagaa
tcaggatcaaggatggatgtccttgctcggcagattgctaatcagtgcccggatccatct
tgcaaacaggacctgttggcctacctggaacagataaaattctactcccaccaactgaaa
atctgcagtcaagttaaagctgagatccagaacctgggaggagagctcatcatgtcagct
ttggacagtgtcacctccctgatccaagcagctaaaaatttaatgaatgctgtggtgcaa
acagtgaaaatgtcttacattgcctcaacgaagatcatccgaatccagagtcctgccggg
ccccggcacccagttgtgatgtggagaatgaaggctcctgcaaaaaaacccttgattaaa
agagagaagccagaggaaacatgtgcagctgtcagacgaggctcagcaaagaaaaaaatc
catccagtgcaagtcatgagtgaatttagaggacgacaagtctactga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037437
Entry
101037437         CDS       T04350                                 

Gene name
CTNNA2
Definition
(RefSeq) catenin alpha-2 isoform X4
  KO
K05691  catenin alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04390  Hippo signaling pathway
sbq04520  Adherens junction
sbq04670  Leukocyte transendothelial migration
sbq05100  Bacterial invasion of epithelial cells
sbq05200  Pathways in cancer
sbq05213  Endometrial cancer
sbq05226  Gastric cancer
sbq05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101037437 (CTNNA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101037437 (CTNNA2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101037437 (CTNNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101037437 (CTNNA2)
  09162 Cancer: specific types
   05226 Gastric cancer
    101037437 (CTNNA2)
   05213 Endometrial cancer
    101037437 (CTNNA2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101037437 (CTNNA2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101037437 (CTNNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sbq04812]
    101037437 (CTNNA2)
Cytoskeleton proteins [BR:sbq04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     101037437 (CTNNA2)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 101037437
NCBI-ProteinID: XP_003922592
UniProt: A0A2K6T587
LinkDB
Position
Unknown
AA seq 953 aa
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGD
PLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQD
NMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTA
GAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGRASQLSTHL
PTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVN
SPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgacttcggcaacttcacctatcattttgaaatgggaccccaaaagtttggaaatccgg
acactaactgtggaaaggctgttggagccccttgttacacaggtgactacacttgtcaac
acaagcaacaaaggcccatctggtaaaaagaaagggagatcaaagaaagcccatgtacta
gctgcctctgtagagcaagccactcagaacttcctggaaaagggtgaacagattgctaag
gagagtcaagatctcaaagaagagttggtggctgctgtagaggacgtgcgcaaacaaggt
gagacgatgcgtatcgcctcctccgagtttgctgatgacccatgctcatcggtaaagcgc
ggcaccatggtgcgggcggcaagggctttgctctcggcagtgacacgcttactcatcctt
gcggacatggcagatgtcatgagacttttatcccatctgaaaattgtggaagaggccttg
gaagctgtcaaaaatgctacaaatgagcaagacctcgcaaaccgttttaaagagtttgga
aaagagatggtgaaacttaactatgtagcagcaagaagacaacaggaactgaaggatcct
cactgtcgggatgagatggcagccgcccgaggggctctgaagaagaatgccacaatgctg
tacacggcctctcaagcatttctccgtcacccagatgttgccgctacgagagccaaccga
gattatgtgttcaaacaagtccaggaggccattgctggcatctccaatgctgctcaagct
acctcgcccactgacgaagccaaaggccacacgggcatcggcgagctggctgcggctctt
aatgagtttgacaataagattatcctggaccccatgacgttcagcgaggccaggttccgg
ccgtccttggaggagaggctggagagcatcatcagcggcgccgcgctgatggcggactcc
tcctgcacgcgggacgaccggcgcgagaggatcgtggcggagtgcaacgccgtgcggcag
gcgctccaggacctgctcagcgagtacatgaataatactggaagaaaagaaaaaggagac
cctctcaacattgcgattgataagatgactaagaaaacaagagatctaaggagacagctt
cggaaagcagtgatggatcacatatctgattctttcttggaaaccaatgtccctttgcta
gttctcattgaggctgcaaagagcggaaatgagaaggaagtgaaagaatatgcccaggtt
ttccgtgaacatgccaacaaactggtagaggttgctaatttggcctgttccatctccaac
aatgaagaaggggtgaaattagttcggatggcagccacccaaattgacagcctgtgtccc
caggtcatcaatgctgctctgacactggctgcccggccacagagcaaagttgcccaggat
aacatggatgtcttcaaagaccagtgggagaagcaggtccgagtgttgacagaagctgtg
gatgacatcacctcagtggatgacttcctctctgtctcagaaaatcacatcttggaggac
gtgaacaagtgtgtgatagccctccaagagggtgatgtggacactctggaccggactgca
ggggccatcaggggccgagcagctcgagtcatacacatcatcaacgctgagatggagaac
tatgaagctggggtgtataccgagaaagtgctggaagctacaaaactgctttctgaaaca
gtgatgccacgctttgctgaacaagtagaggttgccattgaagccctgagtgccaacgtt
cctcaaccatttgaggagaatgagttcatcgatgcctctcgcctggtgtatgacggtgtt
cgggacatcagaaaggctgtgctgatgatcaggaccccagaagaactagaggatgattct
gactttgagcaggaagattatgatgtgcgcagcaggacaagtgttcagactgaggatgac
cagctcattgcagggcagagtgcacgggccatcatggcgcaactaccgcaagaggagaag
gcaaaaatagctgagcaggtggagatattccatcaagagaaaagcaagctggatgcagaa
gtggccaaatgggacgacagcggcaatgatatcattgtactggccaagcagatgtgtatg
atcatgatggaaatgacagacttcacaagaggcaaaggcccattgaaaaatacatctgat
gtcattaatgctgccaagaaaattgccgaagcaggttctcgaatggacaaattagcccgc
gctgtggctgatcagtgtcctgattcagcatgtaagcaggatttattagcctaccttcaa
cgaattgccttgtattgccatcagcttaatatctgcagcaaggtgaaggcggaagtgcag
aatctgggaggagagctcattgtgtcagggacaggagttcagagcactttcactaccttt
tatgaggtagattgtgatgtcatagatgggggcagggctagtcaactttctacccacctc
ccaacctgtgctgagggagctccgatcgggagtggaagcagtgattcctccatgctggac
agtgccacatcacttatccaggcagctaaaaatctgatgaatgctgttgtcctcacggtg
aaagcatcctatgtggcctcaaccaaataccagaaggtctatgggacagcagctgtcaac
tcacctgttgtgtcttggaagatgaaggctccagagaagaagccccttgtgaagagagaa
aagcctgaagaattccagacacgagttcgacgaggttctcagaagaaacacatttcgcct
gtacaggctttaagtgaattcaaagcaatggattccttctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038365
Entry
101038365         CDS       T04350                                 

Gene name
CTNNA1
Definition
(RefSeq) catenin alpha-1 isoform X1
  KO
K05691  catenin alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04390  Hippo signaling pathway
sbq04520  Adherens junction
sbq04670  Leukocyte transendothelial migration
sbq05100  Bacterial invasion of epithelial cells
sbq05200  Pathways in cancer
sbq05213  Endometrial cancer
sbq05226  Gastric cancer
sbq05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101038365 (CTNNA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101038365 (CTNNA1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101038365 (CTNNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101038365 (CTNNA1)
  09162 Cancer: specific types
   05226 Gastric cancer
    101038365 (CTNNA1)
   05213 Endometrial cancer
    101038365 (CTNNA1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101038365 (CTNNA1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101038365 (CTNNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sbq04812]
    101038365 (CTNNA1)
Cytoskeleton proteins [BR:sbq04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     101038365 (CTNNA1)
SSDB
Motif
Pfam: Vinculin Peptidase_C5
Other DBs
NCBI-GeneID: 101038365
NCBI-ProteinID: XP_003933979
UniProt: A0A2K6SS14
LinkDB
Position
Unknown
AA seq 906 aa
MTAVHAGNINLKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLDKGDKIAKESQFLKEELVAAVEDVRKQGDLMKTAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALST
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgactgctgttcacgcaggcaacataaacctcaagtgggaccccaaaagtctagagatc
aggactctggcagttgagagacttttggagccccttgttacacaggttacaaccctggta
aacaccaatagtaaggggccctctaataagaagagaggtcgttccaagaaggcccatgtt
ttggctgcatctgttgaacaagcaactgagaatttcttggacaagggggataaaattgca
aaggagagccagtttctcaaggaggagcttgtggctgctgtagaagatgttcgaaaacaa
ggtgatttgatgaagactgctgcgggagagttcgcagacgatccctgctcttctgtaaag
cgaggcaacatggttcgggcggctcgagctttgctctctgctgttacccggttgctgatt
ttggctgacatggcagatgtctacaaattacttgttcagctgaaagttgtggaagatggt
atcttgaagttaaggaatgctggcaatgaacaagacttaggaatacagtataaagcccta
aaacctgaagtggataagctgaacattatggcagccaaaaggcaacaggaactgaaagat
gttggccatcgtgatcagatggctgcagctagaggaatcctgcagaagaatgttccgatc
ctctatactgcatcccaggcatgcctacagcaccctgatgtcgcagcctataaggccaac
agggacctgatatacaagcagctgcagcaggcggtcacaggcatttctaatgcagcccag
gccactgcctcagatgatgcctcccagcaccagggcggaggaggaggagaactggcatat
gcactcaataactttgataaacaaatcattgtggaccccttgagcttcagtgaggagcgc
tttaggccttccctggaggagcgcctggaaagcatcattagcggggctgccttgatggct
gactcatcctgcactcgtgacgatcgtcgtgagcgaattgtggcagaatgtaacgctgtt
cgccaggccctgcaggacctgctttcggagtacatgggcaatgctggacgtaaagaaaga
agtgatgcactcaattctgcaatagataaaatgaccaagaagaccagggacttgcgtaga
cagctccgcaaagctgtcatggaccatgtttcagattcttttctggaaaccaatgttcca
cttttggtattgattgaagctgcaaagaatggaaatgagaaagaagttaaggagtatgcc
caagtttttcgtgaacatgccaacaagttgattgaggttgccaacttggcctgttccatc
tcaaataatgaagaaggtgtaaagcttgttcgaatgtctgcaagccagttagaagccctc
tgtcctcaggttatcaacgctgcattggctttagcagcaaaaccacagagtaaactggcc
caagagaacatggatctttttaaagaacaatgggaaaaacaagtccgtgttctcacagat
gctgtcgatgacataacttccattgatgacttcttggctgtctcagagaatcacattttg
gaagacgtgaacaaatgtgtcattgctctccaagagaaggatgtggacggcctggaccgc
acagctggtgcaattcgaggccgggcagcccgggtcattcacgtagtcacctcagagatg
gacaactatgagccaggagtctacacagagaaggttctggaagccactaagctgctctct
aacacagtcatgccacgttttactgagcaagtagaagcagccgtggaagccctcagcacg
gaccctgcccagcccatggatgagaatgagtttatcgacgcctcccgcctggtatatgat
ggcatccgggacatcaggaaagcagtgctgatgataaggacccctgaggagttggatgac
tccgactttgagacggaagatttcgatgtcagaagtaggacgagcgtccagacagaagat
gatcagctgatagctggccagagtgcccgggcgatcatggctcagcttccccaggagcag
aaagcgaagattgcagaacaggtggccagcttccaggaagaaaagagcaagctggatgcc
gaagtgtccaaatgggacgacagtggcaatgacatcattgtgctggccaagcagatgtgc
atgattatgatggagatgactgactttacccgaggtaaaggaccactcaaaaatacatca
gatgtcatcagtgctgccaagaaaattgctgaggcaggatccaggatggacaagcttggc
cgcaccatcgcagaccactgccccgactcggcctgcaagcaggacctgctggcctacctg
cagcgcatcgccctctactgccaccagctcaacatctgcagcaaggtcaaggctgaggtg
cagaatctcggcggggagctcgttgtctctggggtggacagcgccatgtccctgatccag
gcagccaagaacttgatgaatgccgtggtccagaccgtgaaggcatcttacgtcgcctct
accaaataccaaaagtcgcagggtatggcttccctcaaccttcctgctgtgtcatggaag
atgaaggcaccagagaaaaagcccttggtgaagagagagaaacaggatgagacacagacc
aagattaaacgggcatcacagaagaagcacgtgaacccggtgcaggccctcagcgagttc
aaagccatggacagcatctag

DBGET integrated database retrieval system