KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030478
Entry
101030478         CDS       T04350                                 

Gene name
TFE3
Definition
(RefSeq) transcription factor E3 isoform X1
  KO
K09105  transcription factor E3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04137  Mitophagy - animal
sbq05202  Transcriptional misregulation in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101030478 (TFE3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101030478 (TFE3)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101030478 (TFE3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101030478 (TFE3)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    101030478 (TFE3)
SSDB
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH
Other DBs
NCBI-GeneID: 101030478
NCBI-ProteinID: XP_003939608
UniProt: A0A2K6V532
LinkDB
Position
Unknown
AA seq 575 aa
MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENILD
PDSFYELKSQPLPLRSSLPISLQATPATPATLSASSSAGGSRTPAMSSSSSSRVLLRQQL
MRAQAQEQERRERREQAAAAPFPSPAPASPAISVVGVSAGGHTLSRPPPAQVPREVLKVQ
THLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPASAQPLPAPEAAHTTGPT
GSAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEMLSYLPGGTTGLQLPSTLPVSG
NLIDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDNHNLIERRRRF
NINDRIKELGTLIPKSSDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQAN
RSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVA
GGPAQNASHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGA
LSPLRAASDPLLSSVSPAVSKASSRRSSFSMEEES
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgtctcatgcggccgagccagctcgggatggcgtagaggccagcgcggagggccctcga
gccgtgttcgtgctgttggaggagcgcaggccggccgactcggctcagctgctcagcctg
aactctttgcttccggaatccgggattgttgctgacatagaattagaaaacatccttgat
cctgacagcttctacgagctcaaaagccaacccttaccccttcgctcaagcctcccaata
tcactgcaggccacgccagccaccccagctacactctctgcatcgtcttctgcagggggc
tccaggacccctgccatgtcgtcatcttcttcatcgagggtcttgctgcggcagcagcta
atgcgggcccaggcacaggagcaggaaaggcgtgagcgtcgggaacaggccgccgcagct
cccttccccagtcctgcacctgcctctcctgccatctctgtggttggcgtctctgctggg
ggccacacattgagccgtccaccccctgctcaggtgcccagggaggtgctcaaggtacaa
acccacctagagaacccgacgcgctaccacctgcagcaggcacgccggcagcaggtgaaa
cagtacctgtccaccacgctcgggcccaagctggcttcccaggccctcaccccaccacca
gggcctgcaagtgcccagccactgcctgctcctgaggctgcccacactaccggccccaca
ggcagtgcgcccaacagccccatggcgctgctcaccatcgggtccagctcagagaaggag
attgatgatgtcattgatgagatcatcagcctggagtccagttacaatgatgaaatgctc
agctatctgcctggaggcaccacaggactgcagctccccagcacgctgcctgtgtcaggg
aatctgatcgatgtgtacagtagtcaaggcgtggccacgccagccatcactgtcagcaac
tcctgcccagctgagctgcctaacatcaaacgggagatctctgagaccgaggcaaaggcc
cttttgaaggaacggcagaagaaagacaatcacaacctaattgagcgtcgcaggcgattc
aacattaacgacaggatcaaggaactgggcactctcatccctaagtccagtgacccggag
atgcgctggaacaagggcaccatcctgaaggcctctgtggattatatccgcaagctgcag
aaggagcaacagcgctccaaagacttggagagccggcagcgatccctggagcaggccaac
cgcagcctgcagctccgaattcaggagctagaactgcaggcccagatccatggcctgccg
gtacctcccacgccagggctgctctccctggccacgacctcagcctctgacagcctcaag
ccagagcagctggacattgaggaggagggcaggccaggcgcggcaacgttccatgtagcg
gggggacctgcccagaatgcttcccatcagcagccccccgcaccgccctcggatgccctt
ctggacctgcactttcccagtgaccacctaggggacctgggagaccccttccacctgggg
ctggaggacattctaatggaggaggaggagggggtggtgggaggactgtcggggggtgcc
ctgtccccactgcgggctgcctccgatcccctgctctcttcagtgtcccctgctgtctcc
aaggccagcagccgccgcagcagcttcagcatggaggaggagtcctga

DBGET integrated database retrieval system