KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030507
Entry
101030507         CDS       T04350                                 

Gene name
DCC
Definition
(RefSeq) netrin receptor DCC
  KO
K06765  deleted in colorectal carcinoma
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04360  Axon guidance
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    101030507 (DCC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101030507 (DCC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101030507 (DCC)
SSDB
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 ig Ig_2 V-set Pur_ac_phosph_N C2-set_2 Interfer-bind Ig_4 Ig_6 Herpes_gE EphA2_TM CD34_antigen V-set_CD47 Protocadherin FAM176
Other DBs
NCBI-GeneID: 101030507
NCBI-ProteinID: XP_003926109
UniProt: A0A2K6UKZ8
LinkDB
Position
Unknown
AA seq 1447 aa
MENSLGCVWVPKLAFVLFGASLLSAHLQVTGFQIKAFTALRFLSEPSDAITMRGGNVLLD
CSAESDRGVPVIKWKKDGIHLALGMDERKQQLSNGSLLIQNILHSRHHKPDEGLYQCEAS
LGDSGSIISRTAKVAVAGPLRFLSQTESVTAFVGDTVLLKCEVIGEPMPTIHWQKNQQDL
TPIPGDSRVVVLPSGALQISRLQPGDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQL
YFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNV
TDDDSGMYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECTVSGKPVP
TVNWMKNGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQTSAQLIVPKP
AIPSSSVLPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTT
QPGSLQLTVGNLKPEAIYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLQAVSTS
PTSILITWEPPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYSLRFLA
YNRYGPGVSTDDITVVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKI
RHRKTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDL
DESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRY
YSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFPTSVPDL
STPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSASAKYKSEDT
TSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKP
RAVIVSWQPPLEANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMYYF
RIQARNSKGVGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPPI
GQMHPPHGSVTPQKNSNLLVIIVVTIGVITVLVIVIAAVICTRRSSAQQRKKRATHSVGK
RKGSQKDLRPPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQDLTPVSHSQSETQLGS
KSTSHSGQDTEEVGSSMSTLERSLAARRAPRAKLMIPMDAQSNNPAVVSAIPVPTLESAQ
YPGILPSPTCGYPHPQFTLRPVPFPTLSVDRGFGAGRSQSVSEGPTTQQPPMLPPSQPEH
SSSEEAPSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVK
TASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVYEQDDLSEQMASLEGLMKQLN
AITGSAF
NT seq 4344 nt   +upstreamnt  +downstreamnt
atggagaatagtcttggatgtgtttgggtacccaagctggcttttgtactcttcggagct
tccctgctcagcgcgcatcttcaagtaaccggttttcaaattaaagctttcacggcactg
cgcttcctctcagaaccttctgatgccatcacaatgcgaggaggaaacgtccttctggac
tgctctgcagagtctgaccgaggagttccagtgatcaagtggaagaaagatggcatccac
ctagccttgggaatggatgaaaggaagcagcaactttcaaatgggtctctgttgatacaa
aacatacttcattccagacaccacaagccagatgagggactttaccaatgtgaagcatct
ttaggagattctgggtcaattattagtcggacagcaaaagttgcagtagcaggaccactg
agattcctttcccagacagaatctgtcacagcctttgtgggagacacagtgctactcaag
tgtgaagtcattggggagcccatgccaacaatacactggcagaagaaccaacaagacctg
actccgatcccaggtgactcccgagtggtggtcttgccctctggagcattgcagatcagc
cgactccaaccaggggacattggaatttaccgatgctcagctcgaaatccagccagctca
agaacaggaaatgaagcagaagtcagaattttatcagatccaggactgcatagacagctg
tattttctgcaaagaccatccaatgtagtagccattgaaggaaaagatgctgtcctggaa
tgttgtgtttctggctatcctccgccaagttttacctggttacgaggcgaggaagtcatc
caactcaggtctaagaagtattctttattgggtggaagcaacttgcttatctccaatgtg
acagacgatgacagtggaatgtatacctgtgttgtcacgtataaaaatgagaatattagt
gcctctgcagagctcacagtcttggttccgccatggtttttaaatcatccttccaacctc
tatgcctatgaaagcatggatattgagtttgaatgtacagtctctggaaagcctgtgccc
actgtgaattggatgaagaatggagatgtggtcattcctagtgattattttcagatagtg
ggaggaagcaacttacggatacttggggtggtgaagtcagatgaaggcttttatcaatgt
gtagctgaaaatgaggctggaaatgctcagactagtgcacagctgatcgtccctaagcct
gctatcccaagctccagtgtcctcccttcagctcccagagatgtggtccctgtcttggtt
tccagccggtttgtccgtctcagctggcgcccacctgcagaagcgaaagggaacattcaa
accttcacggtctttttctccagagaaggtgacaacagggagcgagcattgaatacaaca
cagcctgggtcccttcagctcactgtgggaaacctgaagccagaagccatctacactttc
cgagttgtggcttacaatgaatggggacccggagaaagttctcaacccatcaaggtggcc
acacagcctgagttacaagttccagggccagtagaaaacctgcaagccgtatctacctca
cctacctcaattcttattacctgggaaccccctgcctatgcaaatggtccagtccaaggt
tacagattgttctgcactgaggtgtccacgggaaaagaacagaatatagaggttgatgga
ctatcttataaactggaaggcctgaaaaaattcaccgaatatagtcttcgattcttagct
tataatcgctacggcccaggagtatctactgatgatataacagtggttacactttctgat
gtgccaagtgctccacctcagaacgtctccctggaagtggtcaattcaagaagtatcaaa
gttagctggctgcctcctccatcagggacacaaaatggatttattactggatataaaatt
cgacacagaaagacgacccgcaggggtgagatggaaacactggagccaaacaacctctgg
tacctattcacaggactggagaaaggaagtcagtacagtttccaggtgtcagccatgaca
gtcaatggtactggaccaccttccaactggtatactgcggagaccccagagaatgatcta
gatgaatctcaagttcctgatcaaccaagctctcttcatgtgagaccccagactaactgc
atcataatgagttggactcctcccttgaacccaaacattgtggtccgaggttatattatc
ggttatggcgttgggagcccttatgctgagacagtgcgtgtggacagcaagcagcgatat
tattccattgagagattagagtcaagttcccattatgtaatctccctaaaagcttttaac
aatgcaggagaaggagttcctctttatgaaagtgccaccaccaggtctataacagatccc
actgacccagttgattattatcctttgcttgatgatttccccacctcggtcccagatctc
tccacccccatgctcccaccagtaggtgtacaggctgtggctcttacccacgatgctgtg
agggtcagctgggcagacaactctgtccctaagaaccaaaagacatctgaggtgcgactt
tacactgtccggtggagaaccagcttttctgcgagtgcaaaatacaagtcagaagacaca
acatctctaagttacacagcaacaggcctcaaaccaaacacaatgtatgaattctcagtc
atggtaacaaaaaacagaaggtccagtacttggagcatgacggcgcatgccaccacgtat
gaagcagctccgacctctgctcccaaggatttgacagtcattaccagggaagggaagcct
cgtgccgtcattgtgagttggcagcctcccttggaagccaatgggaaaattaccgcttac
atcttattttataccttggacaagaacatcccaattgatgactggattatggaaacaatc
agtggtgatcggcttactcatcaaatcatggatctcaaccttgacacgatgtattacttt
cgaattcaagcgcgaaattcgaaaggagtggggccactctctgatcctatcctcttcagg
actctgaaagtggaacaccctgacaaaatggctaatgaccaaggtcgtcatggagatgga
ggttattggccagttgatactaatttgattgatagaagcaccctaaatgagccgccaatt
ggacaaatgcaccccccacacggcagcgtcactcctcagaagaacagcaacctgcttgtg
atcattgtggtcacgattggtgtcatcacagtactggtgatcgtcattgcagctgtgatt
tgtacccgacgctcttcagcccagcagagaaaaaaacgagccacccacagtgttggcaaa
aggaagggcagccagaaggacctccgaccccctgatctttggatccatcatgaagaaatg
gagatgaaaaatattgagaagccatccggcactgaccctgcaggaagggactctcccatc
caaagttgccaagacctcacaccagtcagccacagccagtcagaaacccaactgggaagc
aaaagcacctctcattcaggtcaagacactgaggaagtggggagctctatgtccactctg
gagaggtcgctggctgcacgccgagccccccgggccaagctcatgattcccatggatgcc
cagtccaacaatcctgctgttgtgagcgccatccctgtgccaaccctagaaagtgcccag
tacccaggaatcctcccgtctcccacctgtggatatccccacccgcagttcactctccgg
cctgtgccattcccaacactgtcagtggaccgaggttttggagcaggaagaagtcagtca
gtgagtgaaggaccaaccacccaacaaccacccatgctgcccccatctcagcctgagcat
tccagcagtgaggaggcaccaagcagaaccatccccacggcttgtgttcgaccaactcat
ccactccgcagctttgccaatcctttgctacctccaccaatgagtgcaatagaaccgaaa
gtcccttacacaccacttttgtctcagccagggcccactcttcctaagacccatgtgaaa
acagcctcccttgggttggctggaaaagcaaggtcccctttgcttcctgtgtctgtgcca
acagcccctgaagtgtctgaggagagccacaaaccaacagaggattcagccaatgtgtat
gaacaggatgatctgagtgaacaaatggcaagtttggaaggactcatgaagcagcttaat
gccatcacaggctcagccttttaa

DBGET integrated database retrieval system