KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030586
Entry
101030586         CDS       T04350                                 

Gene name
GK2
Definition
(RefSeq) glycerol kinase 2
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00561  Glycerolipid metabolism
sbq01100  Metabolic pathways
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    101030586 (GK2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101030586 (GK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101030586 (GK2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     101030586 (GK2)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101030586 (GK2)
SSDB
Motif
Pfam: FGGY_N FGGY_C
Other DBs
NCBI-GeneID: 101030586
NCBI-ProteinID: XP_003923988
LinkDB
Position
Unknown
AA seq 553 aa
MAAPKKAVVGPLVGAVVQGTNSTRFLVFSSKTAELLSHHRVELTQEFPKEGWVEQDPKEI
LQSVYECIARTCEKLDELDIDISNIKAVGVSNQRETTIIWDKLTGEPLYNAVVWLDLRTQ
ATVEDLSKKIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRNVQKAVEEGRALFGTIDS
WLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKELCDFFEIPMGILPNVFSSSEIY
GIIQAGTLEGVPISGCLGDQCAALVGQMCLQEGQAKNTYGTGCFLLCNTGRKCVFSEHGL
LTTVAYKLGREKPVYYALEGSVAIAGAVIRWLRDNLGIIETSKDIEKLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPLR
HLQVDGGMTKNNVLMQLQADILHIPVIKSFMPETTALGAAMAAGAAEGVNVWSLEPQALS
VLRMERFEPQIQATESEIRYATWKKAVMKSMGWVTSQSPESSDSSIFSSLPLGFFIVSSM
VILIGARYISGIP
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggcagcccccaagaaagcagttgtggggccgttggtgggagcagtggtccagggtacc
aactccactcgctttctggttttcagttcaaaaacagcggaactacttagtcatcacaga
gtggaattaacacaagagttcccaaaagaaggttgggtggaacaagacccgaaggaaatt
cttcagtctgtctatgagtgtatagcgagaacgtgtgagaaacttgacgaactggatatt
gatatatccaacataaaagctgttggtgtcagcaatcagagggaaaccactataatctgg
gacaagttaactggagagcctctctacaatgctgtggtgtggcttgatctaagaacccag
gctaccgttgaggatcttagtaaaaaaattccgggaaataacaacttcgtcaagtctaag
acaggcctcccacttagcacttacttcagtgcagtaaaacttcgttggctgctcgacaat
gtgagaaacgtccaaaaggctgttgaagaaggtagagctctttttggtaccattgattca
tggcttatctggagtttaacaggaggagttaatggaggtgtgcattgcacagacgtaaca
aatgcaagtaggacaatgctttttaatatccattctttggaatgggataaagagctctgt
gacttttttgaaattccaatgggcattcttccaaatgtcttcagttcgtctgagatctat
ggcataattcaagctgggaccctggaaggtgtgccaatatctgggtgtttgggggaccaa
tgtgctgcattggtaggacaaatgtgcctccaagaaggacaagccaaaaacacctatgga
acaggttgcttcttactatgtaatacaggtcgtaaatgtgtgttttctgaacatggcctt
ctgaccacagtagcttacaaactaggcagagagaaaccagtatattatgcactggaaggt
tctgttgctatagcaggtgctgttattcgttggctaagagacaatcttggaattatagag
acctcaaaagacattgaaaaacttgctaaagaagtaggaacttcttacggctgttacttt
gtcccagccttttcggggttatatgcaccttattgggagcccagtgcaagagggatactc
tgtggtctcactcagtttaccaataaatgtcatattgcttttgctgcattagaagctgtt
tgtttccaaactcgagagattttggaagccatgaaccgtgactgtggaattccacttcgt
catctgcaagtagatggaggaatgaccaaaaacaacgttcttatgcaactacaagcagat
attctgcatattccagtaataaagtcattcatgcctgaaacaactgcactaggagctgcc
atggcagcaggagctgcagaaggagtaaatgtttggagtcttgaaccccaggctttgtca
gttctcaggatggaacgatttgaaccacagatccaggccacagaaagtgaaattcgctat
gctacatggaagaaagccgtaatgaagtcaatgggttgggttaccagtcagtctcctgaa
agtagtgattcttctatcttctctagtctgcctttgggattttttatagtgagtagcatg
gtaatactaattggagcgagatatatctcaggtataccataa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030588
Entry
101030588         CDS       T04350                                 

Gene name
GK
Definition
(RefSeq) glycerol kinase isoform X2
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00561  Glycerolipid metabolism
sbq01100  Metabolic pathways
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    101030588 (GK)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101030588 (GK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101030588 (GK)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     101030588 (GK)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101030588 (GK)
SSDB
Motif
Pfam: FGGY_N FGGY_C DUF4501
Other DBs
NCBI-GeneID: 101030588
NCBI-ProteinID: XP_003924116
UniProt: A0A2K6UFH3
LinkDB
Position
Unknown
AA seq 553 aa
MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQ
STVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVKKVQKAVEEKRALFGTIDS
WLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIY
GLMKAGALEGVPISGCLGDQSAALVGQMCFQNGQAKNTYGTGCFLLCNTGHKCVFSDHGL
LTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS
HLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLS
AVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGDPSIFCSLPLGFFIVSSM
VMLIGARYISGIP
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggcagcttcaaagaaggcagttttggggccattggtgggggcggtggaccagggcacc
agttcgacgcgctttttggttttcaattcaaaaacagctgaactacttagtcatcatcaa
gtggaaataaaacaagagtttccaagagaaggatgggtggaacaggaccctaaggaaatt
ctacattctgtctatgagtgtatagagaaaacatgtgagaaacttggacagctcaatatt
gatatttccaacataaaagctattggcgtcagcaaccagagagaaaccactgtagtctgg
gacaagttaactggagagcctctctacaatgctgtggtgtggcttgatctaagaacccag
tctaccgttgaaagtcttagtaaaagaattccaggaaataataactttgtcaagtccaag
acaggccttccacttagcacctacttcagtgcagtgaaacttcgctggctccttgacaat
gtgaaaaaagttcaaaaggctgttgaagaaaaacgagctctttttgggactattgattca
tggcttatttggagtttgacaggaggagtcaatggaggtgtccactgtacagatgtgaca
aatgcaagtaggactatgcttttcaacattcattctttggaatgggataaacagctctgc
gaattttttggaattccaatggaaattcttccaaatgtccggagttcttccgagatctat
ggcctaatgaaagctggggccttggaaggtgtgccaatatctgggtgtttaggggaccag
tctgctgcattggtgggacaaatgtgcttccagaatggacaagccaaaaatacgtatgga
acaggatgtttcttactatgtaatacaggccataagtgtgtattttctgatcatggtctt
ctcaccacagtggcttacaaacttggcagagacaaaccggtatattatgcattggaaggt
tccgtagctatagctggtgctgttattcgctggctaagagacaatcttggaattataaag
acctcagaagaaattgaaaaacttgctaaagaagttggtacttcttatggctgctacttt
gtcccagcattttcagggttatatgcaccttattgggagcccagtgcaagagggataatc
tgtggactcactcagttcaccaataaatgccatattgcttttgctgcattagaagctgtt
tgtttccaaactcgagagattttggatgccatgaatcgggactgtggaattccactcagc
catttgcaggtagatggaggaatgaccagcaacaaaattcttatgcagctacaagcagac
attctgtatattccagtagtgaagccctcgatgcctgaaaccactgcactgggtgctgcc
atggcagcaggggctgcagaaggagtcggcgtatggagtcttgaacccgaggatttgtct
gccgtcacaatggagcggtttgaacctcagattaatgctgaggaaagtgaaattcgttat
tctacgtggaagaaagctgtgatgaagtcaatgggttgggttacaactcaatctccagaa
agtggtgaccctagtatcttctgtagtctgcccttgggcttttttatagtgagtagcatg
gtaatgttaatcggagcaaggtacatctcaggtattccataa

DBGET integrated database retrieval system