KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030594Help
Entry
101030594         CDS       T04350                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101030594 (MAPK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101030594 (MAPK6)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101030594 (MAPK6)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101030594 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 101030594
NCBI-ProteinID: XP_003941666
UniProt: A0A2K6T295
LinkDB All DBs
Position
Unknown
AA seq 721 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPIHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTSYS
TEPCWQYPDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAGKEREKNQGFDFDSFIAGTIQLSSQ
HEPTDVVDKLNDLNSSVSQLELKSLISKSVSQEKQEKGMANLAQLEALYQSSWDSQFVSG
GEDCFFINQFCEVRKDEQLEKENTYTSYLDKFFSRKEDTEMLEMEPTEDGKLGERGNEEG
FLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKHL
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggttttgatctgggttctaggtat
atggacttaaaaccattgggttgtggaggcaatggcttggttttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtccttaccgatccccagagtgtcaaa
catgctctacgtgaaatcaaaattattagaagacttgatcatgataacattgtgaaagtg
tttgaaattcttggtcccagtggaagccaattaacagacgatgtgggctctcttacggag
ctgaacagtgtttacattgttcaggagtacatggagacagacttggccaatgtgctggag
cagggccctttactggaagagcatgccagacttttcatgtatcagctgctacgggggctc
aagtatattcactctgcaaatgtactgcacagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagataggtgactttggtcttgcacggatcatggatcct
cattattcccataagggtcatctttctgaaggattggttactaaatggtacagatctcca
cgtcttttactttctcctaataattacacgaaagccattgatatgtgggcagcaggctgc
atctttgctgaaatgctgactggtaaaaccctttttgcaggtgcacatgaacttgaacag
atgcagctgattttagaatctattccggttgtacatgaggaagatcgtcaggagcttctc
agcgtaattccagtttacattagaaatgacatgactgagccacacaaacctttaactcag
ctgcttccaggaattagtagagaagcactggatttcctggaacaaattttgacatttagc
cccatggatcggttaacagcagaagaagcgctctcccatccttacatgagcatatattct
tttccaatggatgagccaatttcaagccatccttttcatattgaagatgaagttgatgat
attttgcttatggatgaaactcatagtcacatttataactgggaaaggtaccatgattgt
cagttttcagagcatgattggcctatacataacaactttgatattgatgaagttcagctt
gatccaagagctctgtctgatgtcactgatgaagaggaagtacaagttgatccccgaaaa
tatttggatggagatcgggaaaagtatctggaagatcctgcctttgataccagttactct
actgagccttgttggcagtacccagatcatcatgaaaacaaatactgtgatctggagtgt
agccatacttgtaactacaaaacaaggtcatcatcatatttagataacttagtttggaga
gagagtgaagttaaccattactatgaacccaagcttattatagatctttccaattggaaa
gaacaaagcaaagaaaaatctgataagaaaggcaaatcaaaatgtgaaaggaatggattg
gttaaagcccagatagcactagaggaagcatcacagcaactggctggaaaagaaagggaa
aagaatcagggatttgattttgattcctttattgcaggaactattcagcttagttcccaa
catgaacctactgatgttgttgataaattaaatgacttgaatagctcagtgtcccaacta
gagttgaaaagtctgatatcaaaatcagtaagccaagaaaaacaggaaaaaggaatggca
aatttggcccaattagaagccttgtaccagtcttcttgggacagtcagtttgtgagtggt
ggggaggactgttttttcataaatcagttttgtgaggtaaggaaggatgaacaacttgag
aaggaaaacacttacactagttacctggacaagttctttagcaggaaagaagatactgaa
atgctagaaatggagcccacagaggatgggaagcttggagagagaggaaatgaggaagga
tttctgaacaacagtggggagttcctctttaacaagcagctcgagtccataggcatcccg
cagtttcacagtccagttgggtcaccactcaagtctatacaggccaccttaacaccttct
gctatgaaatcttcccctcagattcctcacaaaacatacagcagcattctgaaacatctg
aactaa

DBGET integrated database retrieval system