KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030811
Entry
101030811         CDS       T04350                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta
  KO
K11220  signal transducer and activator of transcription 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04062  Chemokine signaling pathway
sbq04217  Necroptosis
sbq04380  Osteoclast differentiation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq05140  Leishmaniasis
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05212  Pancreatic cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101030811 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101030811 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101030811 (STAT1)
   04621 NOD-like receptor signaling pathway
    101030811 (STAT1)
   04625 C-type lectin receptor signaling pathway
    101030811 (STAT1)
   04658 Th1 and Th2 cell differentiation
    101030811 (STAT1)
   04659 Th17 cell differentiation
    101030811 (STAT1)
   04062 Chemokine signaling pathway
    101030811 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101030811 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    101030811 (STAT1)
   04919 Thyroid hormone signaling pathway
    101030811 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101030811 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101030811 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101030811 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101030811 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101030811 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101030811 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101030811 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101030811 (STAT1)
   05160 Hepatitis C
    101030811 (STAT1)
   05171 Coronavirus disease - COVID-19
    101030811 (STAT1)
   05164 Influenza A
    101030811 (STAT1)
   05162 Measles
    101030811 (STAT1)
   05168 Herpes simplex virus 1 infection
    101030811 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101030811 (STAT1)
   05169 Epstein-Barr virus infection
    101030811 (STAT1)
   05165 Human papillomavirus infection
    101030811 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101030811 (STAT1)
   05140 Leishmaniasis
    101030811 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101030811 (STAT1)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101030811 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra
Other DBs
NCBI-GeneID: 101030811
NCBI-ProteinID: XP_003940862
UniProt: A0A2K6SQM4
LinkDB
Position
Unknown
AA seq 750 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATICFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYNCLKEERKILENAQ
RFNQAQLGSIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKNLEDLQDEYDFKCKTLQNR
EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
QRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEQDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQST
DNLLPMSPEEFDEVSRIVGSVEFDSMMNAV
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgtctcagtggtatgaacttcagcagcttgactcaaaattcctggagcaggttcaccag
ctttatgatgacagctttcccatggaaatccgacaatacttggcacagtggttagaaaag
caagactgggagcatgctgccaatgatgtttcatttgccaccatttgttttcatgacctc
ctgtcgcagctggatgaccaatatagtcgcttttctttggagaataactttttgttacag
cataacataaggaaaagcaagcgtaatcttcaggataattttcaggaagacccaatccag
atgtctatgatcatttataactgtctgaaggaggaaaggaaaattttggaaaatgcccag
agatttaatcaggctcagctggggagtattcagagcacagtgatgctagacaaacagaaa
gagcttgacagcaaagtcagaaacgtgaaggacaaggttatgtgtatagagcatgaaatc
aagaacctggaagatttacaagatgaatatgactttaaatgcaaaaccttgcagaacaga
gaacacgagaccaatggtgtggcaaagagtgatcagaaacaagaacagctgttactcaag
aagatgtatttaatgcttgacaataaaagaaaggaagtagttcacaaaataatagagttg
ttgaatgtcactgaacttacccagaatgccctgattaacgatgaactagtggagtggaag
cagagacagcagagtgcctgtattgggggaccacccaatgcttgcctggatcaactgcag
aactggttcaccatagttgcagagagtctgcagcaagttcggcagcagcttaaaaagctg
gaggaattggaacagaaatacacctatgaacaagaccctatcacaaaaaacaaacaagtg
ttatgggaccgcaccttcagtcttttccagcaactcattcagagctcatttgtggtggaa
agacaaccctgcatgcctacgcaccctcagaggccgctggtcttgaagactggggtccag
ttcactgtgaagttgagactgttggtgaaattgcaagagctgaattataatttgaaagtc
aaagtcttatttgataaagatgtgaatgagagaaatacagtaaaaggatttaggaagttc
aacattttgggcacacacacgaaagtgatgaacatggaggagtccacgaatggcagtctg
gcggctgaatttcggcacctgcaattgaaagaacagaaaaatgctggcaccagaacgaat
gagggtcctctcatcgttactgaagagcttcactcccttagttttgaaacccaattgtgc
cagcctggtttggtgattgacctcgagacgacctctctgcctgtcgtggtgatctccaac
gtcagccagctcccgagcggctgggcctccatcctttggtacaacatgctggtggcggaa
cccaggaatctgtccttcttcctgaatccaccatgtgcacgatgggctcaactttcagag
gtgctgagttggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctgaac
atgttgggagagaagcttcttggtcctaacgccagccccgatggtcttattccgtggacg
aggttttgtaaggagaatataaatgataaaaattttcccttctggctttggattgaaagc
attctagaactcattaaaaaacatctgctccctctctggaatgatgggtgcatcatgggc
ttcatcagcaaggaacgagagcgcgccttgttgaaggaccagcagccggggaccttcctg
ctgcggttcagtgagagctcccgggaaggggccatcacattcacatgggtggagcggtcc
cagaacggaggcgaaccttacttccatgcagttgaaccctacacgaagaaagaactttct
gccgttactttccctgacatcattcgcaattacaaagtcatggctgctgagaatattcct
gagaatcccctgaagtatctgtatccaaatattgacaaagaccatgcctttggaaagtat
tactccaggccaaaggaagcaccagagccaatggaacttgatggccctaaaggaactgga
tatatcaagactgaattgatttctgtgtctgaagttcacccttctagacttcagtccaca
gacaacctgctccctatgtctcctgaggagtttgacgaggtgtctcggatagtgggctcc
gtcgaattcgacagtatgatgaatgcagtatag

DBGET integrated database retrieval system