KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030855Help
Entry
101030855         CDS       T04350                                 

Gene name
OGDHL
Definition
(RefSeq) 2-oxoglutarate dehydrogenase-like, mitochondrial
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00020  Citrate cycle (TCA cycle)
sbq00310  Lysine degradation
sbq00380  Tryptophan metabolism
sbq01100  Metabolic pathways
sbq01200  Carbon metabolism
Module
sbq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbq_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101030855 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    101030855 (OGDHL)
   00380 Tryptophan metabolism
    101030855 (OGDHL)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     101030855 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 101030855
NCBI-ProteinID: XP_010338904
UniProt: A0A2K6S9C5
LinkDB All DBs
Position
Unknown
AA seq 1011 aa AA seqDB search
MSQLRLLPSRLGAQAARLLAAHDVPVFGWRSRSSGPPAAFPSSKGGGGSSYMEEMYFAWL
ENPQSVHKSWDSFFRKASEEASSGSAQPQPTSAPTRESRSVVSSRTKTSKLVEDHLAVQS
LIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAFYDLQETDLDKEFQLPMTT
FIGGSENTLSLREIIRRLENTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSSEEKR
TLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTVIDKSSEMGIENVILGMPHR
GRLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRNITLSLVA
NPSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSY
TTNGTVHIVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCSVAAE
WRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTL
QEFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPATGISED
VLTHIGSVASSVPLEGFKIHTGLSRILRGRADMIKNRTVDWALAEYMAFGSLLKEGIHVR
LSGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGY
AMASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSS
ARPERFLQMSNDDSDAYPAFTKDFEVSQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKP
LIIFTPKSLLRHPEAKSSFDQMVSGTSFQRVIPEDGVAAQAPEQVRRLIFCTGKVYYDLV
KERSSQGLEEKVAITRLEQISPFPFDLIKQEAEKYPRAELAWCQEEHKNMGYYDYISPRF
TTTLRRTRPIWYVGRDPAAAPATGNRNTHLVSLKKFLDTAFNLQAFEGKTF
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagctgaggctgctgccatcccgtcttggggcacaggccgcgaggctcctggct
gcacacgatgtcccggtgtttggctggcgcagcaggtcctctgggccaccagccgccttc
ccaagcagcaaaggtggaggtggctccagttacatggaggagatgtacttcgcctggctg
gaaaacccccagagtgtccacaagtcctgggacagcttcttccggaaagccagcgaagaa
gcctcttctggctctgctcagccacagcccacttctgctcccacccgtgagagcaggtct
gtagtctcaagccggaccaagaccagcaagttggtggaggaccacctggccgtgcagtcc
ctgatccgggcctaccagatccggggtcaccacgtggcccagctggaccccctgggcatt
ctggatgcagacctggactcctttgtgccctcagacttgatcacaaccattgataaactg
gccttctatgacctgcaggagactgacctcgacaaggagttccagctgcccatgaccacc
ttcatcgggggatctgaaaacactctctctctgcgggagatcattcggcgcctggagaac
acctactgccagcacattggcctggagttcatgttcatcaatgatgtggagcagtgtcag
tggatccggcagaagtttgagacccctggtgtgatgcagttctccagcgaggagaagcgg
acgctgctggcccggctggtgcgctccatgagatttgaagacttcctggcccggaagtgg
tcctcagagaagcgatttggcctggagggctgtgaagtgatgattcctgccctcaagacc
gtcatcgacaaatccagcgaaatgggaatcgagaatgtcatcttggggatgccacacagg
ggcaggctgaacgtgctggccaacgtgatccgcaaggacctggagcagatcttctgccag
tttgaccccaagctggaggcggcggacgagggctccggggatgtcaagtaccacctgggc
atgtaccatgagaggatcaaccgtgtcaccaacaggaacatcactctgtcactggttgcc
aacccctcccacctggaggcagtggaccctgtggtgcaggggaagacaaaagcagagcag
ttctaccgtggagacgcccagggcaagaaggtcatgtccatcctggttcacggggatgca
gcctttgccggccagggcgtggtgtatgagaccttccatctgagtgacctgccctcctat
acgaccaacggcaccgtgcacatcgtcgtcaataaccagattggcttcaccacggacccc
cggatggcccgctcctcaccataccccactgacgtggcccgggtggtcaatgcacccatc
ttccatgtgaatgccgatgacccagaggctgtgatgtacgtgtgcagcgtggctgccgag
tggagaaacaccttcaacaaagacgttgttgtggacctggtctgttaccgccggcgtggc
cacaacgagatggatgagcccatgttcacccagccactcatgtacaagcagatccacaga
caggtgcctgtgctgaagaagtatgcagacaagcttattgctgagggcacggtcaccctg
caggagtttgaggaagaaattgccaaatatgaccggatctgtgaggaagcttatggcagg
tccaaagataaaaagatcctgcatataaagcactggctggactccccctggcccggcttc
ttcaacgtagatggagagcccaagagcatgacgtgcccagccacaggcatctctgaggac
gtgctcacccacatcggcagcgtggccagctctgtgcccctggagggctttaagatacac
actggcctctctcgcattctgcggggccgggcggacatgatcaagaaccggacagtggac
tgggcgttggcagagtacatggcctttggctctctgctgaaggagggtatccacgtgcgg
ctcagtgggcaggatgtggagaggggcacattcagtcaccggcaccacgttctccatgac
caggaggttgaccgcaggacgtgcgtgcctatgaatcatctctggcccgaccaggccccg
tacactgtgtgcaacagctccctctcggagtacggagtcctgggctttgagctgggctat
gccatggccagccccaatgccctggtcctctgggaggcccagtttggggacttccacaac
acagcccagtgcatcatcgaccagttcatcagcactggccaggccaagtgggtgaggcat
aacggcattgtgctgctgctgccccatggcatggaaggcatgggcccggagcattcgtca
gcgaggcctgagaggttcctgcagatgagcaatgacgactcagatgcctaccctgcattc
accaaggacttcgaggtgagccagctctatgactgcaactggatcgtggtcaactgctcc
acgccggccaactacttccacgtgctgcgccggcagatcctgctgcccttccgcaagccg
ctgattatcttcacacctaaatctctgctgaggcacccagaggccaagtccagctttgac
caaatggtatccggaaccagcttccagcgggtgattcctgaagatggggtggcagcgcag
gcccctgagcaggtacggcggctcatcttctgcacgggaaaggtgtactacgacctggtg
aaggagcggagcagccagggtctggaggagaaggtggccatcacgcgcctggagcagatc
tctccgttccccttcgacctgatcaagcaggaggcagagaagtacccacgtgcggagctg
gcctggtgtcaggaggagcacaagaacatgggctactatgactacatcagcccacgcttc
acgaccaccctgaggcgcacgcggcccatatggtatgtcggccgggacccagcggctgca
ccagccacaggaaacaggaacactcacctggtgtcactgaagaagtttctggatactgcc
ttcaatctccaggcctttgagggcaagacattttag

DBGET integrated database retrieval system