KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030923
Entry
101030923         CDS       T04350                                 

Gene name
SOCS6
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04630  JAK-STAT signaling pathway
sbq04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101030923 (SOCS6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101030923 (SOCS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101030923 (SOCS6)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101030923 (SOCS6)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 101030923
NCBI-ProteinID: XP_010335031
UniProt: A0A2K6SFT9
LinkDB
Position
Unknown
AA seq 534 aa
MKKISLKTFRKSFNLNKSKEETDFMVVQQPSLAGDFGKDDSLFGSCYGKDMASCDINSED
EKGGKNRSKSESLMGTLKRRLSAKQKKGKAGAPSGSCADEDTFSSSSAPIVFKDVRAQRP
IRSTSLRSHHYSPTPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQPE
TACQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSYC
LDSSSPMEVSAVPPQVGGHSFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSPR
AGHDDVPPLSPLLPPIQNNQIQRNFSGLPGTEAHVAESMRCHLNFDPNSAPGVARVYDSV
QSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLS
FRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSA
TYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgaagaaaattagtcttaaaaccttccggaaatcttttaacttgaataaaagtaaagaa
gaaactgatttcatggtagtacaacaaccgtcgctagccggtgactttggaaaagatgat
tccttatttggtagctgctacggtaaagatatggccagctgcgatatcaacagtgaagat
gaaaaaggcggaaaaaacagatcaaaaagcgagagcctgatgggtacgctaaaaaggcgg
ctttctgcaaaacagaaaaaaggcaaggcaggcgcaccctctgggagctgtgctgacgag
gacaccttctcctcctcctcagcacccatcgtctttaaagacgtgagagctcagaggccg
ataaggtccacctccctccgcagccatcactacagccccacgccttggcctcttcggccc
acaaactccgaggagacgtgcatcaagatggaggtgagagtcaaggccttggttcactct
tccagcccgagtccagccctcaacggcgtccggaaggatttccacgatctccagcctgag
accgcgtgccaagagcaagccaattcactgaagagctcagcttcgcataacggagacctg
catcttcacctggatgaacatgtgcctgtcgttattggacttatgcctcaggactacatt
cagtatactgtgcctttagatgaggggatgtatcctttggaaggatcacgtagctattgt
ctggacagttcttctcccatggaagtctctgcggttcctcctcaagtgggagggcactct
ttcccggaagacgagagtcaggtagaccaggacctcgtcgttgccccggagatcttcgtg
gatcagtcggtgaatggcttgttgattggcaccacgggagtcatgctgcagagcccgagg
gcgggtcacgatgatgtccctccactctcaccattgctacctccaatacagaataatcaa
atccaaaggaacttcagtggactccctggcacagaggcccatgtggctgaaagtatgcgc
tgtcatttgaattttgatcctaactctgctcctggggttgcaagagtttatgactcagtg
caaagcagtggtcccatggttgtgacaagccttacagaggagctgaaaaaacttgcaaag
caaggatggtactggggaccaatcacacgttgggaggcagaagggaagctagcaaacgtg
ccagatggttctttccttgtccgggacagttctgacgaccgttatcttttaagcttgagc
tttcgctcccatggtaaaacacttcacactagaattgagcactcaaacggtaggtttagc
ttttatgaacagccagatgtggaaggacacacgtccatagttgatctaattgagcattca
atcagggactctgaaaatggagctttttgttattcaaggtctcggctgcctgggtctgcg
acttaccccgtcagactgaccaacccagtgtcccggttcatgcaggtgcgctcgctgcag
tacctgtgtcgctttgttatacgtcagtataccaggatagacttaattcagaaactgcct
ttgccaaacaaaatgaaggattatttacaggagaagcactactga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034850
Entry
101034850         CDS       T04350                                 

Gene name
SOCS4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04630  JAK-STAT signaling pathway
sbq04910  Insulin signaling pathway
sbq04917  Prolactin signaling pathway
sbq04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101034850 (SOCS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101034850 (SOCS4)
   04917 Prolactin signaling pathway
    101034850 (SOCS4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101034850 (SOCS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101034850 (SOCS4)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101034850 (SOCS4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 101034850
NCBI-ProteinID: XP_003930559
UniProt: A0A2K6S8A8
LinkDB
Position
Unknown
AA seq 440 aa
MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSDAETVNDIEKTEV
SLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSDEWVSTDLSQTELRDGQLKRSN
VEENINCFSHTNVQPCVITTNNISCREGPMTGSVMNLVSNNSIEDSDMDSDDEILTLCTS
SRKRNKPKWELGDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQQC
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcagaaaataatgaaaatattagtaaaaatgtagatgtaaggcccaaaactagtcgg
agcagaagtgccgacagaaaagacggttatgtgtggagtggaaagaagttatcttggtca
aaaaagagtgagagttgttcagatgctgaaacagtgaatgatatagagaaaactgaagtt
tctttaaggaaccaagaaaggaagcacagctgttcatccattgagttggacttagatcat
tcctgtgggcatagatttttaggccgatctcttaaacagaaactgcaggatgctgtgggg
cagtgttttccaataaagaattgtagtagtcggcactcttccgggcttccatctaaaagg
aaaattcatatcagtgaactcatgttagataagtgtcctttcccacctcgatcagattta
gcctttaggtggcattttattaaacgacacactgctcctataaattccaaatcagatgaa
tgggtaagcacagacttgtctcagactgaattgagggatggtcagctaaaacgaagcaat
gtggaagaaaatataaactgtttctcacataccaatgttcagccctgtgtcataaccacc
aacaacatttcgtgtagagaaggtcctatgactggctctgtgatgaacctggtttcaaat
aacagtatagaagatagtgatatggattctgatgatgaaattctaacactttgcacaagc
tccagaaaaagaaacaaacccaaatgggaattgggtgatgagatcctgcagttggaaaca
cctcctaaataccatacacagattgattacgtccactgtcttgtaccagacctccttcag
atcaataacaatccatgttactggggagtgatggataaatacgcagccgaagcactactg
gaaggaaaaccagagggtacctttttacttcgagattcagcacaggaagactatttattc
tctgttagttttagacgctatagtcgttctcttcatgctagaattgaacagtggaatcac
aactttagctttgatgcacatgatccctgtgtcttccattctcctgacattactgggctc
ctagaacattataaggacccaagcgcctgtatgttctttgaaccacttctatccactcct
ttaattcggactttccctttttccctgcagcatatatgcagaacagttatttgtaactgt
acaacttatgatggcattgatgcccttccaattccttcttctatgaaattatatctgaag
gaatatcattataaatcaaaagttagagtactcaggattgatgcaccagaacaacaatgc
tag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040467
Entry
101040467         CDS       T04350                                 

Gene name
SOCS2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04630  JAK-STAT signaling pathway
sbq04910  Insulin signaling pathway
sbq04917  Prolactin signaling pathway
sbq04930  Type II diabetes mellitus
sbq04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101040467 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101040467 (SOCS2)
   04917 Prolactin signaling pathway
    101040467 (SOCS2)
   04935 Growth hormone synthesis, secretion and action
    101040467 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101040467 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101040467 (SOCS2)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101040467 (SOCS2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 101040467
NCBI-ProteinID: XP_003929616
UniProt: A0A2K6TM51
LinkDB
Position
Unknown
AA seq 198 aa
MTLRCVEPSGNGGEGTRSQWGTAGSVEEPSPEAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIVCVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcgtcgagccctccgggaatggcggagaagggacgcggagtcagtgg
gggaccgcggggtcggtggaggagccatccccggaggcggcgcgactggcgaaggccctg
cgagagctcggtcagacaggttggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcaccagaaggaactttcttgattagagatagctcgcattcagactac
ctactaacaatatctgttaaaacatcagctggaccaactaatcttcgaatcgaataccaa
gacgggaaattcagattggactctatcgtatgtgtcaagtccaagcttaaacagtttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacaggtcca
gaagccccccggaatggcactgttcacctttatctgaccaaacctctctacacatcagca
ccatctctgcagcatctctgtaggctcaccattaacaaatgtaccggtgccatctgggga
ttgccgttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043236
Entry
101043236         CDS       T04350                                 

Gene name
SOCS7
Definition
(RefSeq) suppressor of cytokine signaling 7
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04630  JAK-STAT signaling pathway
sbq04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101043236 (SOCS7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101043236 (SOCS7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101043236 (SOCS7)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101043236 (SOCS7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 101043236
NCBI-ProteinID: XP_003931533
UniProt: A0A2K6UF59
LinkDB
Position
Unknown
AA seq 508 aa
GVKTVGGGCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLVLEGLESEAESLETNS
CSEEELSSPGRGGGGGGGRLLLQPPGPELPLVPFPLQDLVPLGRLSRGEQQQQQPPPPPP
PPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDGTGKRPSGELAASAASLTDMGG
SAGREPDAGRKPRLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTSPHPPTPPPPPR
RSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIAPIRAAESLHSQPP
QHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYI
LSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRS
RVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYY
YDPQEEVYLSLKEAQLISKQKQEVEPST
NT seq 1527 nt   +upstreamnt  +downstreamnt
ggggtcaagacggtcggtgggggttgctgcccgtgcccgtgcccccctcagccgccccct
ccgcagccccagccgcctgctgccgccccgcaggccggggaggatcccacggaaacgagc
gacgcgctgctggtcctggagggtttggaatcggaggccgagagcctggagactaacagc
tgctcggaagaggagctcagcagtccgggtcgcggaggaggaggagggggcggccggctt
ctgctgcaacccccaggccctgaattacctctggtgcccttcccgctgcaggacttggtc
cccctggggcgcctgagtagaggggagcagcagcagcagcaacctcccccgcccccgcct
cctcccggccccctccggcctctggcgggcccttctcggaagggctccttcaaaatccgc
ctcagtcgcctcttccgcaccaaaagctgcaacggtggctccggcggtggggatgggacc
ggcaagaggccttctggagagctggctgcttcagctgcaagtctgacagacatgggaggt
tctgcgggccgggagccggacgcggggaggaaacccaggttgacaagaactcaaagtgcc
ttttctccggtctccttcagccccctgttcacaggtgaaactgtgtcgcttgtggatgtg
gacatttctcagcggggcctgacctctccacaccctccaactccccctcctcctccaaga
agaagcctcagccttctagatgatatcagtgggacgctgcctacatctgtccttgtggct
ccgatggggtcttccttgcagtctttccccctacctccgcctcctccaccccatgcccca
gatgcatttccccggattgctcccatccgagcagctgaatccctgcacagccaaccgcca
cagcacctccagtgtcccctctaccgacctgactcgagcagctttgcagccagccttcga
gagctggagaagtgtggttggtattgggggccaatgaattgggaagatgcagagatgaag
ctgaaagggaaaccagatggttctttcctggtacgagacagttctgatcctcgttacatc
ctgagcctcagtttccgatcacagggtatcacccaccacactagaatggagcactacaga
ggaaccttcagcctatggtgtcatcccaagtttgaggatcgctgtcaatctgttgtagag
tttattaagagagccattatgcactccaagaatgggaagtttctctatttcttaagatcc
agggttccaggactgccaccaactcctgtccagctgctgtatccagtatcccgattcagc
aatgtcaaatccctccagcacctttgcagattccggatacgacagctcgtcaggatagat
catatcccagatctcccactgcctaaacctctgatttcttatatccgaaagttctactac
tatgatcctcaggaagaggtatacctgtctctaaaggaagcgcagctcatttccaaacag
aagcaagaggtggaaccctccacgtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046533
Entry
101046533         CDS       T04350                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04120  Ubiquitin mediated proteolysis
sbq04380  Osteoclast differentiation
sbq04630  JAK-STAT signaling pathway
sbq04668  TNF signaling pathway
sbq04910  Insulin signaling pathway
sbq04917  Prolactin signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04930  Type II diabetes mellitus
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04935  Growth hormone synthesis, secretion and action
sbq05160  Hepatitis C
sbq05164  Influenza A
sbq05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101046533 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101046533 (SOCS3)
   04668 TNF signaling pathway
    101046533 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101046533 (SOCS3)
   04920 Adipocytokine signaling pathway
    101046533 (SOCS3)
   04917 Prolactin signaling pathway
    101046533 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    101046533 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101046533 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101046533 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    101046533 (SOCS3)
   04931 Insulin resistance
    101046533 (SOCS3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101046533 (SOCS3)
   05164 Influenza A
    101046533 (SOCS3)
   05168 Herpes simplex virus 1 infection
    101046533 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101046533 (SOCS3)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101046533 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 101046533
NCBI-ProteinID: XP_003931729
UniProt: A0A2K6S247
LinkDB
Position
Unknown
AA seq 225 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVASLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgcagtgacgggcggcgaggcgaacctgctgctc
agcgcggagcccgccggcacctttctgatccgcgacagctcggaccagcgccacttcttc
acgctcagcgtcaagacgcagtctgggaccaagaacctgcgcatccagtgcgaggggggc
agcttctctctgcagagcgacccccggagcacgcagcccgtgccccgcttcgactgcgtg
ctcaagctggtgcaccactacatgccaccccctggagccccctccttcccctcaccacct
actgaaccctcctccgaggtgcccgagcagccgtctgcccagcccctccctgggagtccc
cccagaagagcctattacatctactccgggggcgagaagatcccgctggtgctgagccgg
cctctctcctccaacgtggccagtcttcagcatctctgtaggaagactgtcaatggccac
ctggactcctatgagaaagtcacccagctgcccgggcccattcgagagttcctggaccag
tatgatgccccgctttaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050319
Entry
101050319         CDS       T04350                                 

Gene name
SOCS5
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04630  JAK-STAT signaling pathway
sbq04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101050319 (SOCS5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101050319 (SOCS5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101050319 (SOCS5)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101050319 (SOCS5)
SSDB
Motif
Pfam: SOCS SOCS_box SH2 BRCT_assoc
Other DBs
NCBI-GeneID: 101050319
NCBI-ProteinID: XP_003926795
UniProt: A0A2K6S890
LinkDB
Position
Unknown
AA seq 536 aa
MDKVGKMWNNFKYRCQNLFSHEGGSHNDNVDMNSNRCLSVKEKNISIGDSTPQQQSSPLR
ENVALELGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDTDKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDSSAIPQANCDSEEDATTLCLQSRRQKQRQVSGDSHTHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaagtgggaaaaatgtggaataacttcaaatacaggtgtcagaatcttttcagt
catgagggaggaagccacaatgacaatgtggacatgaactccaacagatgtttgtctgtc
aaagaaaaaaacatcagcataggagactcaactcctcagcaacaaagcagtcccttacga
gaaaatgttgccttagaactgggattaagcccttcaaagaattcttcaaggagaaatcaa
aattgtgccactgaaatccctcaaattgttgaaataagcatcgaaaaggataatgattct
tgtgttaccccagggacaagacttgcacgaagagattcctactctcgacatgctccttgg
ggtgggaagaaaaaacattcctgttctacaaagacccagagttcattagatactgataaa
aagtttggtagaactcgaagtggacttcaaaggagagagaggcgctatggcgtaagttct
gtgcacgacatggacagtgtttccagcagaactgtaggaagtcgctctctgagacagcgg
ttgcaggatactgtgggcttgtgttttcccatgagaacttacagcaagcagtcaaagcct
ctcttttccaataaaagaaaaatccatctttctgaattaatgcttgagaaatgccctttt
cctgctggttcagatttagctcaaaaatggcatttgattaaacagcatacagctcctgtg
agcccacattcaacattttttgatacatttgatccatctttggtttctacagaagatgaa
gaagataggcttagagagagaaggcggcttagtattgaagaaggggttgatccgcctccc
aatgcacaaatacatacatttgaagctactgcacaggttaatccattatataaactggga
ccaaagttagctcctggaatgactgaaataagtggggacagttctgcaattcctcaagct
aattgtgactcagaagaggatgcaaccaccctgtgtttgcagtcacggaggcagaagcag
cgtcaggtatctggagacagccatacccatgttagcagacagggagcttggaaagtccac
acacagattgattacatacactgccttgtgcctgatttgcttcaaattacagggaatccc
tgttactggggagtgatggaccgttatgaagcagaagcccttcttgaagggaaacctgaa
ggcacgtttttgctcagggactctgcgcaagaggactacctcttctctgtgagcttccga
cgttacaacagatccctgcatgcccgaattgagcagtggaatcacaactttagttttgat
gcccatgacccgtgtgtatttcactcctcgactgtaacaggacttttagaacattataaa
gatccaagttcatgcatgttttttgaaccattgcttactatatcactaaataggactttt
ccttttagcctgcagtatatctgccgtgcggtaatctgcaggtgcactacgtatgatggc
attgatgggctccctctaccctcaatgttacaggattttttaaaagaatatcattataaa
caaaaagttagagttcgctggttagaacgagaaccagtcaaggcaaagtaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050866
Entry
101050866         CDS       T04350                                 

Gene name
SOCS1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04120  Ubiquitin mediated proteolysis
sbq04380  Osteoclast differentiation
sbq04630  JAK-STAT signaling pathway
sbq04910  Insulin signaling pathway
sbq04917  Prolactin signaling pathway
sbq04930  Type II diabetes mellitus
sbq04935  Growth hormone synthesis, secretion and action
sbq05145  Toxoplasmosis
sbq05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101050866 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101050866 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101050866 (SOCS1)
   04917 Prolactin signaling pathway
    101050866 (SOCS1)
   04935 Growth hormone synthesis, secretion and action
    101050866 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101050866 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101050866 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101050866 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101050866 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101050866 (SOCS1)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     101050866 (SOCS1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 101050866
NCBI-ProteinID: XP_003928781
UniProt: A0A2K6SDW8
LinkDB
Position
Unknown
AA seq 211 aa
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSSAPPARPRPCPAAPAPVPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ
RIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 636 nt   +upstreamnt  +downstreamnt
atggtagcacacaaccaggtggcagccgacaatgcagtctccacagcagcagagcctcga
cggcggccagagccttcctcctcttcctcctcctcgtccgcgccccccgcgcgcccgcgg
ccgtgcccggcggccccggccccggtccccggcgacacgcacttccgcacgttccgttcg
cacgccgattaccggcgcatcacgcgcgctagcgcgctcctcgacgcctgcggcttctac
tgggggcccctgagcgtgcacggggcgcacgagcggctgcgcgcggagcccgtgggcacc
ttcctggtgcgcgacagccgccagcggaactgctttttcgccctcagcgtgaagatggcc
tcgggtcccacgagcatccgcgtacacttccaggccggccgcttccacctggacggcagc
cgggagagcttcgactgcctcttcgaactgctggagcactacgtggcggcgccgcgccgc
atgctgggggccccgctgcgccagcgccgcgtacggccgctgcaagagctgtgccgccag
cgtatcgtggccaccgtgggccgcgagaacctggcgcgcatccccctcaaccccgttctc
cgcgactacctgagctccttcccctttcagatttga

DBGET integrated database retrieval system