KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030975
Entry
101030975         CDS       T04350                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04012  ErbB signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04110  Cell cycle
sbq04151  PI3K-Akt signaling pathway
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04934  Cushing syndrome
sbq05162  Measles
sbq05165  Human papillomavirus infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05203  Viral carcinogenesis
sbq05206  MicroRNAs in cancer
sbq05215  Prostate cancer
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101030975 (CDKN1B)
   04066 HIF-1 signaling pathway
    101030975 (CDKN1B)
   04068 FoxO signaling pathway
    101030975 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    101030975 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101030975 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101030975 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    101030975 (CDKN1B)
   05206 MicroRNAs in cancer
    101030975 (CDKN1B)
   05203 Viral carcinogenesis
    101030975 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    101030975 (CDKN1B)
   05220 Chronic myeloid leukemia
    101030975 (CDKN1B)
   05215 Prostate cancer
    101030975 (CDKN1B)
   05222 Small cell lung cancer
    101030975 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101030975 (CDKN1B)
   04934 Cushing syndrome
    101030975 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    101030975 (CDKN1B)
   05169 Epstein-Barr virus infection
    101030975 (CDKN1B)
   05165 Human papillomavirus infection
    101030975 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101030975 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101030975
NCBI-ProteinID: XP_003934578
UniProt: A0A2K6SYS0
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRMSNGSPSLERMDSRQADHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQLKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPAADDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgaatgtctaacgggagtcccagcctggagcggatggactccaggcag
gcggaccaccccaagccctcggcctgcagaaacctcttcggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagctcaagtgg
aatttcgattttcagaatcacaagcccctggagggcaagtacgagtggcaagaggtggag
aagggcagcttgcctgagttctactacagacccccgcggccccccaaaggcgcctgcaag
gtgccggctcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaactctgaggacacccacttggtagacccaaagactgatccgtccgacagc
cagacggggttagcggagcagtgcgcaggaataaggaagcgacctgcagctgacgattct
tctactcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccgaat
gccggttctgtggagcagacgcccaagaagcctggcctcagaagacatcagacgtaa

DBGET integrated database retrieval system