KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030999
Entry
101030999         CDS       T04350                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00562  Inositol phosphate metabolism
sbq01100  Metabolic pathways
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04020  Calcium signaling pathway
sbq04062  Chemokine signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04070  Phosphatidylinositol signaling system
sbq04072  Phospholipase D signaling pathway
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04380  Osteoclast differentiation
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04625  C-type lectin receptor signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04670  Leukocyte transendothelial migration
sbq04722  Neurotrophin signaling pathway
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04919  Thyroid hormone signaling pathway
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05214  Glioma
sbq05223  Non-small cell lung cancer
sbq05225  Hepatocellular carcinoma
Module
sbq_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101030999 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101030999 (PLCG2)
   04014 Ras signaling pathway
    101030999 (PLCG2)
   04370 VEGF signaling pathway
    101030999 (PLCG2)
   04064 NF-kappa B signaling pathway
    101030999 (PLCG2)
   04066 HIF-1 signaling pathway
    101030999 (PLCG2)
   04020 Calcium signaling pathway
    101030999 (PLCG2)
   04070 Phosphatidylinositol signaling system
    101030999 (PLCG2)
   04072 Phospholipase D signaling pathway
    101030999 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101030999 (PLCG2)
   04613 Neutrophil extracellular trap formation
    101030999 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    101030999 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    101030999 (PLCG2)
   04662 B cell receptor signaling pathway
    101030999 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    101030999 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    101030999 (PLCG2)
   04670 Leukocyte transendothelial migration
    101030999 (PLCG2)
   04062 Chemokine signaling pathway
    101030999 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101030999 (PLCG2)
   04919 Thyroid hormone signaling pathway
    101030999 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101030999 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101030999 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    101030999 (PLCG2)
   04380 Osteoclast differentiation
    101030999 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101030999 (PLCG2)
   05206 MicroRNAs in cancer
    101030999 (PLCG2)
   05205 Proteoglycans in cancer
    101030999 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101030999 (PLCG2)
   05214 Glioma
    101030999 (PLCG2)
   05223 Non-small cell lung cancer
    101030999 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101030999 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101030999 (PLCG2)
   05171 Coronavirus disease - COVID-19
    101030999 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101030999 (PLCG2)
   05169 Epstein-Barr virus infection
    101030999 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101030999 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101030999 (PLCG2)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101030999 (PLCG2)
Membrane trafficking [BR:sbq04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101030999 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101030999 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like GDPD
Other DBs
NCBI-GeneID: 101030999
NCBI-ProteinID: XP_003938111
UniProt: A0A2K6TJJ5
LinkDB
Position
Unknown
AA seq 1265 aa
MSTMASVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGNQFVLSTLSLAADSKEDAV
NWLSGLKILHQEAMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLHDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDC
WDGPDGRPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMAKV
FKDIFGDLLLMKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNVEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMENGTLKYY
LTDNLTFNSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDML
MRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADVEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSIVRQKPVDLLKYNQKGLTRIYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKY
MQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILLTLTVKVLGARHLPKPGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLNPIWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKAIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNKRLREKRVSN
SKFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgtccaccatggctagtgtggattcccttgcggaatacgagaagagccagatcaagaga
gccctggagctggggacggtgatgactgtgttcagctttcgtaagtctactcctgagcga
aggaccgtccaggtgatcatggaaacgaggcaggtggcctggagcaagaccgccgacaag
attgagggcttcctggatatcatggaaataaaagaaatccgcccagggaagaactccaaa
gatttcgagcgtgcaaaagcagttcgccagaaagaagactgctgcttcaccatcctatat
ggcaatcagtttgtcctcagcacactcagcttggcagctgactctaaagaggatgcagtt
aactggctctctggcctgaaaatcttacaccaagaagcaatgaatgcatccacacccacc
attatcgagagttggctgagaaagcagatatattctgtggatcaaaccagaagaaacagc
atcagcctccgagagttgaagaccatcttgcccctcgtcaactttaaagtgagcagtgcc
aagttccttaaagataagtttgtggaaataggagcacacaaagatgagctgagctttgag
cagttccatctcttctataaaaaacttatgtttgaacagcaaaaatcgattctcgatgaa
ttcaaaaaggattcgtctgtgttcatcctggggaacacggacaggccggatgcctctgct
gtttaccttcatgactttcagaggtttctcatacatgaacagcaggagcactgggctcag
gatctgaacaaagtccgtgagcggatgacaaagttcatcgatgacaccatgcgtgaaacc
gctgagcctttcttgtttgtggatgagttcctcacgtacctgttttcacgagaaaacagc
atctgggatgagaagtatgacgcggtggatatgcaggacatgaacaaccccctgtctcat
tactggatctcctcgtcacataacacgtacctcacaggtgaccagctgcggagtgagtcg
tccacagaggcctacatccgctgcctgcgcatgggctgtcgctgcatcgaactggactgc
tgggacgggcccgatgggaggccggtcatctaccacggctggacgcggaccactaagatc
aagtttgatgacgtcgtgcaggccatcaaggaccacgcctttgtgacctcgagcttccca
gtgatcctgtccattgaggagcattgcagcgtggagcagcagcgccacatggccaaggtc
ttcaaagacatatttggcgatcttcttctgatgaagcccacggaggccagcgctgaccag
ctgccctcacccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccc
cgaggtgacgtggatgtcaacgtggaggataagaaggatgagcacaagcaacagggagag
ctgtacatgtgggattccatcgaccagaaatggactcggcactactgcgccatcgccgat
gccaagctgtccttcagtgatgacattgaacagactatggaggaggaagtgccccaggat
atacctcccacagagctgcattttggggagaaatggttccacaagaaggtggagaagagg
acgagtgctgagaagttgctgcaggaatactgcatggagacagggggcaaggatggcacc
ttcctggtccgggagagcgagaccttccccaatgactacactctgtccttctggcggtca
ggccgggtccagcactgccggatacgctccaccatggagaatgggaccctgaagtactac
ctgactgacaacctcaccttcaacagcatctacgccctcatccagcactaccgcgagacg
cacctgcgctgtgccgaattcgagctgcggctcaccgaccctgtgcccaaccccaacccc
cacgagtccaagccgtggtactatgacagcctgagtcgcggagaggcagaggacatgctg
atgaggatcccccgggacggagccttcctaatccggaagcgagagggcagcgactcctac
gccatcaccttcagggctaggggcaaggtgaagcactgtcgcatcaaccgggatggccga
cactttgttctgggaacctccgcctattttgagagcctggtggagctcgtcagttactat
gagaagcattcactctaccgaaagatgagactgcgctaccccgtgacgcccgagctcctg
gagcgctacaatatggaaagagatataaactccctctatgacgtcagcagaatgtatgtg
gatcccagtgaaatcaatccgtccatgcctcagagaactgtgaaagccctgtatgactac
aaagccaagcgaagcgatgagctgagcttctgccggggcgccctcatccacaatgtctcc
aaggagcccgggggctggtggaaaggtgactatggaaccaggatccagcagtacttccca
tccaactacgtggaggacatctcaactgcagatgtcgaggagctggaaaagcagatcatt
gaagacaatcccttagggtctctttgcagaggcatattggacctcaatacctataacgtc
gtgaaagccccacaggggaaaaaccagaagccctttgtctttatcctggagcccaagaag
cagggtgatcctccggtggagtttgccacagacagggtggaggagctcttcgagtggttt
cagagcatccgagagatcacctggaagatcgacaccaaggagaacaacatgaagtattgg
gagaagaaccagtctatcgccatcgagctctctgacctggttgtctactgcaaaccaacc
agcaaaaccaaggacaacttagaaaatcctgacttcagagaaatccgctcctttgtggag
acaaaggctgacagcatcgtcagacagaagcccgtcgacctcctcaagtacaatcaaaag
ggactgacccgcatctacccaaagggacaaagagttgactcttccaactatgaccccttc
cgcctctggctgtgcggttctcagatggtggcactcaatttccagacggcagataagtac
atgcagatgaatcacgcattgttttctctgaatgggcgcacgggctacgttctgcagcct
gagagcatgaggacagagaaatacgacccgatgccacccgagtcccagaggaagatcctg
ctgacgctgactgtcaaggttctcggtgctcgccatctccccaaacctggacgaagtatt
gcctgtccctttgtagaggtggagatctgtggagctgagtatgacaacaacaagttcaaa
acgacggttgtgaatgataatggcctcaatcctatctgggctccaacacaggagaaggtg
acatttgaaatttatgacccaaacctggcatttctgcgcttcgtggtttacgaagaagat
atgttcagtgatcccaacttccttgctcatgccacttaccccattaaagcaatcaagtca
ggattcagatctgttcctctgaagaatgggtacagtgaggacatcgagctggcttccctc
ctggttttctgtgaaatgcggccagtcctggagagcgaagaggaactttactcctcctgt
cgccagctgaggcggcggcaagaagaactgaacaaccagctttttctatatgacacacac
cagaacttgcgcaatgccaaccgggatgccctggttaaagagttcaacgttaacgagaac
cagctccagttgtaccaggagaaatgcaacaagaggttaagagagaagagagtcagcaac
agcaagttttactcgtag

DBGET integrated database retrieval system