KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101031112
Entry
101031112         CDS       T04350                                 

Gene name
STAM2
Definition
(RefSeq) signal transducing adapter molecule 2
  KO
K04705  signal transducing adaptor molecule
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04144  Endocytosis
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101031112 (STAM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101031112 (STAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101031112 (STAM2)
Membrane trafficking [BR:sbq04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    101031112 (STAM2)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT ENTH
Other DBs
NCBI-GeneID: 101031112
NCBI-ProteinID: XP_003922025
UniProt: A0A2K6TP42
LinkDB
Position
Unknown
AA seq 525 aa
MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEGITFPPAGSQTVSAAAKNGTSLNKNKEDEDIAKAIELSLQE
QKQQHTETKSLYPSAEIQLNNKVVRKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWW
KGENHRGIGLFPSNFVTTNLNIESEAAAVDKLNVIDDDVEEIKKSEPEPVYIDEDKMDRA
LQVLQSIDPTDSKPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSELNVKVLEALEL
YNKLVNETPVYSVYSKLHPPAHYPAASSVVPMQTYPVQSHGGNYMGQSIHQVTVAPSYSL
GPDQIGPLRSLPPNVNSSVTTHSAQTSYLSTGQDTVSNPTYMNQKSNLQSATGTTAYTQQ
MGISVDMSSYQNTASNLPQLAGFPVTGPAHPAAQQHTNYHQQPLL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgcctttgttcaccgccaaccccttcgagcaagacgtggaaaaggccacaaatgagtac
aacactacagaagattggagtcttattatggatatatgtgacaaagttggaagtacacct
aatggagcaaaagattgcctaaaagccataatgaaaagggtaaatcataaggttcctcat
gttgctctgcaggcactgactcttcttggggcatgtgtggcaaactgtggaaagatattt
catttagaagtatgttcccgtgattttgcaacagaagtacgtgctgtgattaaaaataag
gcacatcctaaagtatgtgaaaaactgaagtctttaatggtggagtggtcagaagaattt
cagaaggaccctcagtttagtctaatatctgcaactattaaatctatgaaagaggaagga
attacttttcctccagcaggttctcagactgtctcagctgctgccaagaatggtacgtca
ttgaacaaaaacaaagaggatgaagacatagctaaagctattgaattatcactgcaagag
cagaaacagcaacacacagaaacaaaatccttatatccatctgcagaaattcagttaaat
aataaggttgtacggaaagtgagagctttatatgattttgaagctgttgaggacaatgaa
ctcacctttaaacatggtgaaataattattgttttggatgacagtgatgccaattggtgg
aaaggagaaaatcacagaggaataggactcttcccatccaattttgtaacaactaattta
aacatagagtctgaggcagcggctgtggacaaattgaatgtaattgatgatgatgtggag
gaaattaagaaatcagagcctgagcctgtttatatagatgaggataagatggatagagcc
ctgcaggtacttcagagtatagatccaacagattcgaaaccagactcccaagaccttttg
gatttagaagatatctgccagcagatgggtccaatgatagatgaaaaacttgaagagatt
gataggaagcattcagaattgtctgaattgaatgtaaaagtcttggaagctctggaactc
tataacaaattggtgaatgaaacaccagtgtactcagtctattcaaagctccaccctcca
gcacattacccagctgcatcatctgtggttccaatgcagacatatccagttcaatcacat
ggtggaaactatatgggtcagagcattcaccaagtaacggttgccccaagctatagccta
ggaccagatcaaattggtccactgagatctctgcctccaaatgtgaattcctcagtgaca
acacattctgctcaaacttcatatttaagcactggacaagacactgtttccaatcctact
tatatgaaccagaaatctaacctacaatcagctactggtacaactgcttacacacagcaa
atggggatctctgtggatatgtcatcttatcagaacactgcttccaatttgcctcaactg
gcaggctttccggtgacaggtccagctcatccagctgcacagcagcacacaaattaccat
cagcagcctctcctttag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046949
Entry
101046949         CDS       T04350                                 

Gene name
STAM
Definition
(RefSeq) signal transducing adapter molecule 1 isoform X1
  KO
K04705  signal transducing adaptor molecule
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04144  Endocytosis
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101046949 (STAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101046949 (STAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101046949 (STAM)
Membrane trafficking [BR:sbq04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    101046949 (STAM)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10
Other DBs
NCBI-GeneID: 101046949
NCBI-ProteinID: XP_003930691
UniProt: A0A2K6TJQ6
LinkDB
Position
Unknown
AA seq 541 aa
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAI
ELSLKEQRQQSTTLSTLYPSTSNLLTNHHHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNT
QMSHLQSYSLPPEQLSSLSQAVGPPSANPALPSQPSQTAYPNTMVSSVQGNTYPSQAPVY
SPPPAAAAAAAATADVTLYQNAGPNVSQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKAL
L
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgcctctctttgccaccaatcccttcgatcaggatgttgagaaagcaaccagcgagatg
aatactgctgaggactggggcctcattttggatatctgtgataaagttggtcagtctcgc
actggacctaaggattgtcttcggtctattatgaggagagtgaaccacaaagatcctcat
gttgctatgcaagctttgactcttctaggagcatgtgtatcaaactgcggcaaaattttt
catttagaagtatgttcaagagattttgctagtgaagtaagcaacgtattaaataagggt
catcctaaagtatgtgaaaaattaaaggctcttatggttgagtggacagatgagtttaag
aatgacccacagcttagtctaatatcagcaatgattaagaaccttaaggaacaaggagtt
acattcccagctattggttctcaggctgcagaacaagccaaagcaagcccagctcttgta
gccaaggatcctggtactgtggctaacaaaaaagaagaagaagatttagcaaaagccatt
gagttgtccctcaaggaacaaaggcagcagtcaaccaccctttccactttgtatccaagc
acatccaacctcttaacgaaccaccaccatgaaggccgaaaagttcgtgctatatatgac
tttgaagctgctgaagataatgaactcacttttaaagctggagagattattacagttctt
gatgacagtgatcctaactggtggaaaggtgaaacccatcaaggcatagggttatttcct
tctaattttgtgactgcagatctcactgctgaaccagaaatgattaaaacagagaagaag
acggtacaatttagtgatgatgttcaggtagaaacaatagaaccagagccagaaccagcc
tttattgatgaggataaaatggaccagttgctacagatgttgcaaagtacagatcccagt
gatgatcagccagacctaccagagctacttcatcttgaggcaatgtgtcaccagatggga
cctctcattgatgaaaagctggaagatattgatagaaaacattcagaactctcagaactt
aatgtgaaagtgatggaggcactttccttatataccaagttaatgaacgaagatcccatg
tattccatgtatgcaaaattacagaatcagccgtattatatgcagtcatctggtgtttct
ggttctcaggtatatgcagggcctcctccaagtggtgcctacctggtcgcggggaacacg
cagatgagccacctccagagctacagtcttcccccggagcagctgtcttctctgagccag
gcagtgggcccgccgtccgcaaacccagcccttcctagtcagccaagtcagaccgcttac
ccaaatacaatggtgagttccgttcaaggaaacacgtatcccagccaggctccggtctat
agtcctcctcctgctgctgctgctgctgctgctgcaactgccgacgtcactctgtaccag
aatgcaggacctaatgtgtcccaggtgccaaactataacttaacatcatccaccctgcct
cagcccggaggcagccaacagccacctcagccacagcaaccatattctcagaaggctctg
ctatag

DBGET integrated database retrieval system