KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101031320
Entry
101031320         CDS       T04350                                 

Definition
(RefSeq) transcription elongation factor B polypeptide 2
  KO
K03873  elongin-B
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04066  HIF-1 signaling pathway
sbq04120  Ubiquitin mediated proteolysis
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101031320
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101031320
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101031320
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101031320
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101031320
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101031320
   03400 DNA repair and recombination proteins [BR:sbq03400]
    101031320
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     101031320
   ECS complex
     101031320
DNA repair and recombination proteins [BR:sbq03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     101031320
SSDB
Motif
Pfam: ubiquitin Rad60-SLD
Other DBs
NCBI-GeneID: 101031320
NCBI-ProteinID: XP_003923554
LinkDB
Position
Unknown
AA seq 119 aa
MDVFLMVRRRKTTIFTNAKESSTVLELKRIVEGILQRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLALRVGDAFEALRIEPFSSPPDLLDMMKPQDSGSSANEQQAVQ
NT seq 360 nt   +upstreamnt  +downstreamnt
atggacgtgtttctcatggtccggcgccgcaagaccaccatcttcacgaacgccaaggag
tccagcacggtgttggagctgaagcgcatcgtggagggaatcctccagcggccacccgac
gagcagcggctgtacaaggacgaccaactcttggatgacggcaagacactgggcgagtgc
ggcttcaccagccaaacagcgcgaccgcaggccccagccaccgtggggctggccttgcgg
gtaggtgacgccttcgaggccctgcgcatcgagccgttctccagtccgcccgatctcctc
gacatgatgaagccccaggattcgggaagcagcgccaatgaacaacaggctgtgcagtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037906
Entry
101037906         CDS       T04350                                 

Gene name
TCEB2
Definition
(RefSeq) transcription elongation factor B polypeptide 2
  KO
K03873  elongin-B
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04066  HIF-1 signaling pathway
sbq04120  Ubiquitin mediated proteolysis
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101037906 (TCEB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101037906 (TCEB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101037906 (TCEB2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101037906 (TCEB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101037906 (TCEB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101037906 (TCEB2)
   03400 DNA repair and recombination proteins [BR:sbq03400]
    101037906 (TCEB2)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     101037906 (TCEB2)
   ECS complex
     101037906 (TCEB2)
DNA repair and recombination proteins [BR:sbq03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     101037906 (TCEB2)
SSDB
Other DBs
NCBI-GeneID: 101037906
NCBI-ProteinID: XP_010337528
LinkDB
Position
Unknown
AA seq 151 aa
MQDNIQHLNKGALVEGAASQENQPKEFAPKPNSNPKGSSQVISLSEPRPPLASSPMQSPA
FSAGPSESLCPPGRYWGRRDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRAEDTFEA
LCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
NT seq 456 nt   +upstreamnt  +downstreamnt
atgcaggacaatatccagcacctaaacaagggcgccttggtggaaggagccgccagccag
gaaaatcaacccaaggagttcgcccctaagcccaacagcaaccccaagggctcctcacag
gtcataagcctctctgagccgcgacctcccctagcatccagcccgatgcagtccccagct
ttctctgcaggcccatcggaatcactctgtccccccggacgctactgggggcgaagggat
gaccaactcttggatgatggcaagacactgggcgagtgtggcttcaccagtcaaacagca
cggccacaggccccagccacagtggggctggccttccgtgcagaggacacctttgaggcc
ctgtgcatcgagccattctccagcccgcccgagttgcccgatgtgatgaagccccaggac
tcgggaagcagtgccaatgaacaagccgtgcagtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050933
Entry
101050933         CDS       T04350                                 

Definition
(RefSeq) uncharacterized protein LOC101050933
  KO
K03873  elongin-B
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04066  HIF-1 signaling pathway
sbq04120  Ubiquitin mediated proteolysis
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101050933
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101050933
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101050933
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101050933
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101050933
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101050933
   03400 DNA repair and recombination proteins [BR:sbq03400]
    101050933
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     101050933
   ECS complex
     101050933
DNA repair and recombination proteins [BR:sbq03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     101050933
SSDB
Motif
Pfam: ubiquitin
Other DBs
NCBI-GeneID: 101050933
NCBI-ProteinID: XP_010349570
LinkDB
Position
Unknown
AA seq 122 aa
MDVFLMIRCHKATIFTDAKESSTVSELKRIVEGILKQPPDEQRCTRMTNSGMMARHWASV
ASPVKQHGHRPQPQWGWPSGQRTPLRPCAWSRSPACPSCPTREAVPMNKPCSEDPEEPHS
LQ
NT seq 369 nt   +upstreamnt  +downstreamnt
atggacgtgttcctcatgatccggtgccacaaggccaccatcttcacggacgccaaggag
tccagcacagtgtccgagctgaagcgcatcgtcgagggcatcctcaagcagccgcccgac
gagcagcgctgtacaaggatgaccaactctgggatgatggcaagacactgggcgagtgtg
gcttcaccagtcaaacagcacggccacaggccccagccacagtggggctggccttccggg
cagaggacacctttgaggccctgtgcatggagccgttctccagcctgcccgagctgcccg
actagggaagcagtgccaatgaacaagccgtgcagtgaggaccccgaagagccccattcc
cttcaataa

DBGET integrated database retrieval system