KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101031357
Entry
101031357         CDS       T04350                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor isoform X2
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01523  Antifolate resistance
sbq04010  MAPK signaling pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04064  NF-kappa B signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04150  mTOR signaling pathway
sbq04210  Apoptosis
sbq04217  Necroptosis
sbq04350  TGF-beta signaling pathway
sbq04380  Osteoclast differentiation
sbq04612  Antigen processing and presentation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04640  Hematopoietic cell lineage
sbq04650  Natural killer cell mediated cytotoxicity
sbq04657  IL-17 signaling pathway
sbq04660  T cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04668  TNF signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04930  Type II diabetes mellitus
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04940  Type I diabetes mellitus
sbq05010  Alzheimer disease
sbq05014  Amyotrophic lateral sclerosis
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05134  Legionellosis
sbq05135  Yersinia infection
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05143  African trypanosomiasis
sbq05144  Malaria
sbq05145  Toxoplasmosis
sbq05146  Amoebiasis
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05205  Proteoglycans in cancer
sbq05310  Asthma
sbq05321  Inflammatory bowel disease
sbq05322  Systemic lupus erythematosus
sbq05323  Rheumatoid arthritis
sbq05330  Allograft rejection
sbq05332  Graft-versus-host disease
sbq05410  Hypertrophic cardiomyopathy
sbq05414  Dilated cardiomyopathy
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101031357 (TNF)
   04350 TGF-beta signaling pathway
    101031357 (TNF)
   04064 NF-kappa B signaling pathway
    101031357 (TNF)
   04668 TNF signaling pathway
    101031357 (TNF)
   04071 Sphingolipid signaling pathway
    101031357 (TNF)
   04150 mTOR signaling pathway
    101031357 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101031357 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101031357 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101031357 (TNF)
   04217 Necroptosis
    101031357 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101031357 (TNF)
   04620 Toll-like receptor signaling pathway
    101031357 (TNF)
   04621 NOD-like receptor signaling pathway
    101031357 (TNF)
   04622 RIG-I-like receptor signaling pathway
    101031357 (TNF)
   04625 C-type lectin receptor signaling pathway
    101031357 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    101031357 (TNF)
   04612 Antigen processing and presentation
    101031357 (TNF)
   04660 T cell receptor signaling pathway
    101031357 (TNF)
   04657 IL-17 signaling pathway
    101031357 (TNF)
   04664 Fc epsilon RI signaling pathway
    101031357 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101031357 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101031357 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101031357 (TNF)
  09163 Immune disease
   05310 Asthma
    101031357 (TNF)
   05322 Systemic lupus erythematosus
    101031357 (TNF)
   05323 Rheumatoid arthritis
    101031357 (TNF)
   05321 Inflammatory bowel disease
    101031357 (TNF)
   05330 Allograft rejection
    101031357 (TNF)
   05332 Graft-versus-host disease
    101031357 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101031357 (TNF)
   05014 Amyotrophic lateral sclerosis
    101031357 (TNF)
   05020 Prion disease
    101031357 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    101031357 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101031357 (TNF)
   05410 Hypertrophic cardiomyopathy
    101031357 (TNF)
   05414 Dilated cardiomyopathy
    101031357 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101031357 (TNF)
   04940 Type I diabetes mellitus
    101031357 (TNF)
   04932 Non-alcoholic fatty liver disease
    101031357 (TNF)
   04931 Insulin resistance
    101031357 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101031357 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101031357 (TNF)
   05135 Yersinia infection
    101031357 (TNF)
   05133 Pertussis
    101031357 (TNF)
   05134 Legionellosis
    101031357 (TNF)
   05152 Tuberculosis
    101031357 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101031357 (TNF)
   05170 Human immunodeficiency virus 1 infection
    101031357 (TNF)
   05161 Hepatitis B
    101031357 (TNF)
   05160 Hepatitis C
    101031357 (TNF)
   05171 Coronavirus disease - COVID-19
    101031357 (TNF)
   05164 Influenza A
    101031357 (TNF)
   05168 Herpes simplex virus 1 infection
    101031357 (TNF)
   05163 Human cytomegalovirus infection
    101031357 (TNF)
   05169 Epstein-Barr virus infection
    101031357 (TNF)
   05165 Human papillomavirus infection
    101031357 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101031357 (TNF)
   05144 Malaria
    101031357 (TNF)
   05145 Toxoplasmosis
    101031357 (TNF)
   05140 Leishmaniasis
    101031357 (TNF)
   05142 Chagas disease
    101031357 (TNF)
   05143 African trypanosomiasis
    101031357 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101031357 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101031357 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101031357 (TNF)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Tumor necrosis fators
   101031357 (TNF)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Cytokines
   101031357 (TNF)
SSDB
Motif
Pfam: TNF Form-deh_trans
Other DBs
NCBI-GeneID: 101031357
NCBI-ProteinID: XP_003944403
UniProt: A0A2K6SIW1
LinkDB
Position
Unknown
AA seq 232 aa
MSTETMIQDVELAEEAFSKTQGPQGSRRRWFLSLFSFLLVAGATALFCLLHFGVIGPQRE
ESSRDFSPINSLALAVRSSSRIPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRD
NQLVVPSDGLYLVYSQVLFKGQGCPSTFTLLTHSISRIAVSYQAKVNLLSAIKSPCQRET
PRGAKTHPWYEPIYLGGVFQLEKGDRLSAEISPPDSLDLAESGQVYFGIIGL
NT seq 699 nt   +upstreamnt  +downstreamnt
atgagcactgaaaccatgatccaggacgtggagctggccgaggaggcgttctccaagacc
caggggccccagggctccagacggcgctggttcctcagcctcttctccttcctgctcgta
gcaggtgccaccgccctcttctgcctgctgcacttcggagtgatcggcccccagagggaa
gagtcctccagagacttctctccaatcaactctctggccctggcagtcagatcatcttct
cgaatcccgagtgacaagcctgtagcccatgttgtagcaaaccctcaggctgaggggcaa
ctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgagagat
aaccagctggtggtgccatcagacgggctgtacctcgtctactcccaggtcctcttcaag
ggccaaggctgcccctccacctttacgctcctcacccacagcatcagccgcatcgctgtc
tcctaccaggccaaggtcaacctcctctctgccatcaagagcccctgccagagggagacc
ccacggggcgctaagacccatccctggtatgagcccatctacctgggaggagtcttccag
ctggagaagggtgatcgactcagcgctgagatcagtccgcctgactctctcgacttggct
gagtctgggcaggtctactttgggatcattggcctgtga

DBGET integrated database retrieval system