KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101031381
Entry
101031381         CDS       T04350                                 

Gene name
PTPN11
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04014  Ras signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04360  Axon guidance
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04670  Leukocyte transendothelial migration
sbq04722  Neurotrophin signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04931  Insulin resistance
sbq05168  Herpes simplex virus 1 infection
sbq05205  Proteoglycans in cancer
sbq05211  Renal cell carcinoma
sbq05220  Chronic myeloid leukemia
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101031381 (PTPN11)
   04630 JAK-STAT signaling pathway
    101031381 (PTPN11)
   04072 Phospholipase D signaling pathway
    101031381 (PTPN11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101031381 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    101031381 (PTPN11)
   04670 Leukocyte transendothelial migration
    101031381 (PTPN11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101031381 (PTPN11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101031381 (PTPN11)
  09158 Development and regeneration
   04360 Axon guidance
    101031381 (PTPN11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101031381 (PTPN11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101031381 (PTPN11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101031381 (PTPN11)
   05211 Renal cell carcinoma
    101031381 (PTPN11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101031381 (PTPN11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101031381 (PTPN11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sbq01009]
    101031381 (PTPN11)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101031381 (PTPN11)
Protein phosphatases and associated proteins [BR:sbq01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    101031381 (PTPN11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 101031381
NCBI-ProteinID: XP_010341243
LinkDB
Position
Unknown
AA seq 529 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESSDGKSKVTHVMIRCQTSTAV
LDQPLNTTRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQ
ENKNKNRYKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNNSKPKKSYIATQ
SKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHFRTWP
DHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILIDIIREKGV
DCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTN
IKYSLADQTSGDQSPLPPCTPTPPCAEMREDNARVYENVGLMQQQKSFR
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccaaatatcactggtgtggaggcagaaaacctacta
ttgacaagaggagttgatggcagttttttggcaaggcctagtaaaagtaaccctggagac
ttcacactttccgttagaagaaatggagctgtcacccacatcaagattcagaacactggt
gattactatgacctgtatggaggggagaagtttgccactttggctgagttggtccagtat
tacatggaacatcatgggcaattaaaagagaagaatggagatgttattgagcttaaatat
cctctgaactgtgcagatcctacctctgaaaggtggtttcatggacacctctctgggaaa
gaagcagagaaattattaactgaaaaaggaaagcatggtagctttcttgtacgagagagc
cagagccaccctggagattttgttctctctgtgcgcaccggtgatgacaaaggggagagc
agtgacggcaagtctaaagtgacccatgtcatgattcgctgtcagacatcaaccgccgta
cttgatcagccccttaacacgactcgtataaatgctgctgaaatagaaagcagagttcga
gaactaagcaaattagctgagaccacagataaagtcaaacaaggcttttgggaagaattt
gagacactacaacaacaggagtgcaaacttctctatagccgaaaagagggtcaaaggcaa
gaaaacaaaaacaaaaatagatataaaaacatcctgccctttgatcataccagggttgtc
ctacacgacggggatcccaatgagcctgtttcagattacataaatgcaaatataatcatg
cctgaatttgaaaccaagtgcaacaattcaaagcccaaaaagagttacattgccacacaa
agtaaatgtgtcaaatactggcctgatgagtatgctctcaaagaatatggggtcatgcgt
gttaggaacgtcaaagaaagtgctgctcatgactatacgctaagagaacttaaactttca
aaggttggacaagggaatacagagagaacggtctggcaataccactttcggacctggccg
gaccacggagtgcccagcgaccctgggggtgtgctggacttcctcgaggaggtgcaccat
aagcaggagagcatcatggatgcagggccggtcgtggtgcactgcagtgctggaattggc
cggacagggacgttcattgtgattgatattcttattgacatcatcagagagaaaggtgtt
gactgtgacattgacgttcccaaaaccatccagatggtgcgatctcagaggtcagggatg
gtccagacagaagcacagtaccgatttatctatatggcggtccagcattatattgaaaca
ctacagcgcaggattgaagaagagcagaaaagcaagaggaaagggcacgaatatacaaat
attaagtattctctagcggaccagacgagtggagatcagagcccgctcccgccttgtact
ccaacgccaccctgtgcagaaatgagagaagacaatgctagagtctatgaaaatgtgggg
ctgatgcaacagcagaaaagtttcagatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033019
Entry
101033019         CDS       T04350                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: tyrosine-protein phosphatase non-receptor type 11-like
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04014  Ras signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04360  Axon guidance
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04670  Leukocyte transendothelial migration
sbq04722  Neurotrophin signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04931  Insulin resistance
sbq05168  Herpes simplex virus 1 infection
sbq05205  Proteoglycans in cancer
sbq05211  Renal cell carcinoma
sbq05220  Chronic myeloid leukemia
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101033019
   04630 JAK-STAT signaling pathway
    101033019
   04072 Phospholipase D signaling pathway
    101033019
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101033019
   04650 Natural killer cell mediated cytotoxicity
    101033019
   04670 Leukocyte transendothelial migration
    101033019
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101033019
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101033019
  09158 Development and regeneration
   04360 Axon guidance
    101033019
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101033019
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101033019
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101033019
   05211 Renal cell carcinoma
    101033019
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101033019
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101033019
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sbq01009]
    101033019
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101033019
Protein phosphatases and associated proteins [BR:sbq01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    101033019
SSDB
Motif
Pfam: Y_phosphatase SH2 DUF4074 DSPc
Other DBs
NCBI-GeneID: 101033019
NCBI-ProteinID: XP_010349983
LinkDB
Position
Unknown
AA seq 596 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPRKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLXEKNGDVMELKYPLNCADPTSERXFHGHLSGK
EAEKXLTEKGKHGSFLVRESQSHPGDFVLSVRTSDDKGESSDGKSKVTHVMIRCQELKYD
DGGERFDSLTDLVEHYXKNPMVETLGTVLQLKQPVSTTHINAAEIESRVRELSKLAETTD
KVKQGFWEEFETLQQQECKLLCRRKEGQRQENKNKNRXKNILPFDHTRVVLHNGDPNEPV
SDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVE
RGESKCVKYWPDEYALKEYGVMHVRNAKESAAHDYTLRELKLSKVGQALLQGNTERMVWQ
YHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGLVVVHCSAGIGWTETFIVIDILID
IIREKGVDCDIDIPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKR
KGHEYTNIKYSLADQMSGDQSPLPPCTPTPPCAEMREHNARVYENVGLMQQQKSFR
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccgaatatcactggtgtggaggcagaaaacctacta
ttgacaagaggagttgatggcagctttttggcaaggcctcgtaaaagtaaccctggagac
ttcacactttctgttagaagaaatggagctgtcactcacatcaagattcagaacactggt
gattactatgacctgtatggaggggagaagtttgccactttggctgagttggtccagtat
tacatggaacatcatgggcaattannagagaagaatggagatgttatggagcttaaatat
cctctgaactgtgcagatcctacctctgaaaggtagtttcatggacacctctctgggaaa
gaagcagagaaatgattaactgaaaaaggaaagcatggtagctttcttgtacgagagagc
cagagccaccctggagattttgttctctctgtgcgcaccagtgatgacaaaggggagagc
agtgacggcaagtctaaagtgacccatgtcatgattcgctgtcaggaactgaaatatgat
gatggaggagaacggtttgattctttgacagatcttgtggaacattactagaagaatcct
atggtggaaacattgggtacagtactacaacttaagcagcccgttagcacgactcatata
aatgctgctgaaatagaaagcagagttcgagaactaagcaaattagctgagaccacagat
aaagtcaaacaaggcttttgggaagaatttgagacactacaacaacaggagtgcaaactt
ctctgtagacgaaaagagggtcaaaggcaagaaaacaaaaacaaaaatagatagaaaaac
atcctgccctttgatcataccagggttgtcctacacaacggggatcccaatgagcctgtt
tcggattacataaatgcaaatataatcatgcctgaatttgaaaccaagtgcaacaattca
aagcccaaaaagagttacattgccacacaaggctgtctgcaaaacacggtgaacgacttt
tggcggatggtgttccaagaaaactcccgagtgattgttatgacaacgaaagaagtggag
agaggagagagtaaatgtgtcaaatactggcctgatgagtatgctctcaaagaatatggg
gtcatgcatgttaggaacgccaaagaaagtgctgctcatgactatacgctaagagaactt
aaactttcaaaggttggacaagctctactccaggggaatacggagagaatggtctggcaa
taccactttcggacctggccggaccacggagtgcccagcgaccctgggggtgtgctggac
ttcctggaggaggtgcaccacaagcaggagagcatcatggatgcagggctggtcgtggtg
cactgcagtgctggaattggctggacagagacgttcattgtgattgatattcttattgac
atcatcagagagaaaggtgttgactgcgacattgacattcccaaaaccatccagatggtg
cgatctcagaggtcagggatggtccagacagaagcacagtaccgatttatctatatggcg
gtccagcattatattgaaacactacagcgcaggattgaagaagagcagaaaagcaagagg
aaagggcacgaatatacaaatattaagtattctctagcggaccagatgagtggagatcag
agcccgctcccgccttgtactccaacgccaccctgtgcagaaatgagagaacacaatgct
agagtctatgaaaatgtggggctgatgcaacagcagaaaagtttcagatga

DBGET integrated database retrieval system