KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101031615
Entry
101031615         CDS       T04350                                 

Gene name
JAK1
Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04380  Osteoclast differentiation
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04621  NOD-like receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq05140  Leishmaniasis
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05212  Pancreatic cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101031615 (JAK1)
   04151 PI3K-Akt signaling pathway
    101031615 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101031615 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101031615 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101031615 (JAK1)
   04658 Th1 and Th2 cell differentiation
    101031615 (JAK1)
   04659 Th17 cell differentiation
    101031615 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101031615 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101031615 (JAK1)
   05203 Viral carcinogenesis
    101031615 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101031615 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101031615 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101031615 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101031615 (JAK1)
   05161 Hepatitis B
    101031615 (JAK1)
   05160 Hepatitis C
    101031615 (JAK1)
   05171 Coronavirus disease - COVID-19
    101031615 (JAK1)
   05164 Influenza A
    101031615 (JAK1)
   05162 Measles
    101031615 (JAK1)
   05168 Herpes simplex virus 1 infection
    101031615 (JAK1)
   05163 Human cytomegalovirus infection
    101031615 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101031615 (JAK1)
   05169 Epstein-Barr virus infection
    101031615 (JAK1)
   05165 Human papillomavirus infection
    101031615 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101031615 (JAK1)
   05140 Leishmaniasis
    101031615 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101031615 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101031615 (JAK1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101031615 (JAK1)
Protein kinases [BR:sbq01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   101031615 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 RIO1 SH2
Other DBs
NCBI-GeneID: 101031615
NCBI-ProteinID: XP_010346437
UniProt: A0A2K6T879
LinkDB
Position
Unknown
AA seq 1153 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVKLEAPEPGVEVIFYLSDREPLQLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNHTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMTKKMQLPELPKDISYKRYIPETLNKSIRQRNPLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLRISSENEMN
WFYSNDSGNVQYYEVMVTGNLGIQWRQKPNVVSVEKEKNKLKRKKLESKHKKDEEKNKVR
EEWSSFSYFPEITHIVIKESLVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEVQGAQKQFKNFQIEVHKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFMLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGT
LMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSEFGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYHLMRKCWEFQPSNRTS
FQSLIEGFEALLK
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagaccgaggtgaagctggaggcccctgagccaggggtggaagtgatcttc
tatctgtcggacagggagcccctccagctgggcagtggagagtacacagcagaggagctg
tgcatcagggctgcacaggcatgccgtatctctcctctttgtcacaacctctttgccttg
tatgatgagaacaccaagctctggtatgctccaaatcacaccatcactgttgatgacaag
atgtccctccggctccactaccggatgaggttctatttcaccaattggcatggaaccaac
gacaatgagcagtcagtgtggcgtcattctccaaagaagcagaaaaatggctacgagaag
aaaaaggttccagatgcaacccctctccttgatgccagttcactggagtatctgtttgct
cagggacagtatgatttggtgaaatgcctggctcccattcgagaccccaagaccgagcag
gatgggcatgatattgagaacgagtgtctggggatggctgtcctggccatctcgcactat
gccatgacgaagaagatgcagttgccagaactgcccaaggacatcagctacaagcgatat
attccagaaacattgaacaagtccatcagacagaggaaccctctcacgaggatgcggatt
aataatgttttcaaggatttcctcaaggaatttaacaacaagaccatttgtgacagcagc
gtgtccacgcatgacctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tacggtgctgaaatatttgagacctccatgttacgaatttcatcagaaaatgagatgaat
tggttttattcaaatgacagtggaaatgttcagtactacgaagtgatggtgactgggaat
cttggaatccagtggagacagaaaccaaatgttgtttctgttgaaaaggaaaaaaataaa
ctgaagcggaagaaactggaaagtaaacacaagaaggatgaagagaaaaacaaggtccgg
gaagagtggagcagtttctcttacttccctgaaatcactcacattgtgataaaggagtct
ctggtcagcatcaacaagcaggacaacaagaaaatggaactgaagctctcttcccatgag
gaggccttgtcctttgtgtccctggtagacggctacttccggctcaccgcagatgcccat
cattacctctgcactgatgtggcccccccgttgatcgtccacaacatacagaatggctgt
cacggtccaatctgtacagaatacgccatcaataaattgcggcaagaaggaagcgaggag
gggatgtacgtgctgaggtggagctgcacggactttgacaacatcctcatgaccgtcacc
tgcttcgagaagtctgaggtgcagggtgcccagaagcagttcaagaactttcagatcgag
gtgcacaagggccgctacagcctgcatggttcggaccgcagcttccccagcttgggagac
ctcatgagccacctcaagaaacagatcctgcgcacggataatatcagcttcatgctgaaa
cgctgctgccagcccaagccccgagaaatctccaacctgctggtggctactaagaaagcc
caggagtggcagcctgtctaccccatgagccagctgagttttgatcggattctcaagaag
gatctggtgcagggcgagcaccttgggagaggcacgagaacacacatctactctgggacc
cttatggattacaaggatgacgaaggaacttctgaagagaagaagataaaagtgatcctc
aaagttttagaccccagccacagggatatttctctggctttcttcgaggcagccagcatg
atgagacaggtctctcacaaacacatcgtgtacctctacggcgtctgtgtccgagacgtg
gagaatatcatggtggaagagtttgtggaaggggggcctctggatctcttcatgcaccgg
aaaagtgatgtccttaccacaccatggaaattcaaagtggccaaacagctcgccagtgcc
ctgagttacttggaggataaagacctggttcatggaaatgtgtgcactaaaaacctcctc
ctggcccgtgagggcatcgacagtgagtttggcccattcatcaagctcagtgaccctggc
atccccatcacggtgctgtctagacaagagtgcattgaacgaatcccatggattgctccc
gagtgtgtggaggactccaagaatctgagtgtggctgctgacaagtggagctttggaacc
acgctctgggaaatctgctacaatggcgagatccccttgaaagacaagactctgattgag
aaagagagattctatgaaagccggtgcaggccggtgacaccgtcgtgtaaggagctggct
gacctcatgacccgctgcatgaactacgaccccaatcagaggcccttctttcgagccatc
atgagagacattaataagcttgaagagcagaatccagatattgtttcagaaaaaaagcca
gcaactgaagtggaccccacacattttgaaaagcgcttcctaaagaggatccgtgacttg
ggagagggccactttgggaaggttgagctctgcaggtatgaccccgaaggggataataca
ggggagcaggtggctgtcaaatctctgaagcctgagagtggaggtaaccacatagctgat
ctgaaaaaggaaattgaaatcttaaggaacctctatcatgagaacattgtgaagtacaaa
ggaatctgcacggaagacggtggaaatggtattaagctcatcatggaatttctgccttcg
ggaagccttaaggaatatcttccaaagaataagaacaaaattaacctcaaacagcagcta
aaatatgccgttcagatttgtaaggggatggactatttgggttctcggcaatatgttcac
cgggacttagcagcaagaaatgtccttgttgagagtgaacaccaagtgaaaattggagac
tttggtttaaccaaagcaattgaaaccgataaggagtattacaccgtcaaggatgaccgg
gacagccctgtgttttggtatgctccagaatgtttaatgcagtctaaattttatattgcc
tctgatgtctggtcttttggagtcactctgcatgagctgctgacttactgtgattcagat
tctagtcccatggccttgttcctgaaaatgataggcccaacccatggccagatgacagtc
acaagacttgtgaatacattaaaagaaggaaaacgcttgccgtgtccacctaactgtcca
gatgaggtttatcaccttatgaggaaatgctgggaattccagccatcaaatcggacaagc
ttccagagccttattgaaggatttgaagcacttttaaaataa

DBGET integrated database retrieval system