KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101031617
Entry
101031617         CDS       T04350                                 

Gene name
SYK
Definition
(RefSeq) tyrosine-protein kinase SYK
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04064  NF-kappa B signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04380  Osteoclast differentiation
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04625  C-type lectin receptor signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq05152  Tuberculosis
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05171  Coronavirus disease - COVID-19
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101031617 (SYK)
   04072 Phospholipase D signaling pathway
    101031617 (SYK)
   04151 PI3K-Akt signaling pathway
    101031617 (SYK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101031617 (SYK)
   04613 Neutrophil extracellular trap formation
    101031617 (SYK)
   04625 C-type lectin receptor signaling pathway
    101031617 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    101031617 (SYK)
   04662 B cell receptor signaling pathway
    101031617 (SYK)
   04664 Fc epsilon RI signaling pathway
    101031617 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    101031617 (SYK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101031617 (SYK)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101031617 (SYK)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101031617 (SYK)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101031617 (SYK)
   05168 Herpes simplex virus 1 infection
    101031617 (SYK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101031617 (SYK)
   05169 Epstein-Barr virus infection
    101031617 (SYK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101031617 (SYK)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101031617 (SYK)
Protein kinases [BR:sbq01001]
 Non-receptor tyrosine kinases
  SYK family
   101031617 (SYK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr SH2 Pkinase
Other DBs
NCBI-GeneID: 101031617
NCBI-ProteinID: XP_010347127
LinkDB
Position
Unknown
AA seq 575 aa
MASSSMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGRITREESEQ
VVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGSQGNNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFP
KPGHRKPSPAQGNRPESTVSFNPYEPELGPWTAEKGPQREALPMDTEVYESPYADPEEIR
PKEVYLDRSLLTLEDKELGSGNFGTVKKGYYQMKKADDIVVTFRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADESYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
NT seq 1728 nt   +upstreamnt  +downstreamnt
atggccagcagcagcatggctgacagcgccaaccacctgcccttcttcttcggcaacatc
acccgggaggaggcagaagattacctggtccaggggggcatgagtgacggactctatttg
ctgcgccagagccgcaactacctgggcggctttgcgctgtccgtggcccacgggaggaag
gcacatcactacaccatcgagcgggagctgaacggtacctatgccatcgccggtggcagg
acccacgccagtcccgctgacctctgccactaccactcccaggagtccgatggcctggtc
tgcctcctcaagaagcccttcaaccggccccagggcgtgcagcccaagactgggcccttt
gaggacctcaaggaaaacctcatcagggaatatgtgaagcagacgtggaatctgcagggt
caggctctggagcaggccatcatcagtcagaagcctcagctggagaagctgatcgccacc
acagcccatgaaaaaatgccttggttccacggaagaatcactcgggaagaatctgagcaa
gttgtcttgataggatcaaagacaaacggaaagttcctgatcagagccagagacaacaac
ggctcctacgccctgtgcctgctgcatgaagggaaggtgctgcactatcgcattgacaaa
gacaagacggggaagctctccatcccagaggggaaaaagttcgacacactgtggcagctg
gtcgagcattattcttataaagcagatggtttgttaagagttcttacagtcccatgtcaa
aaaatcggctcccagggaaataatgttaattttggaggtcgtccacagcttccaggttcc
catcctgcgacttggtcagcgggtggaataatctcaagaatcaaatcatactccttccca
aagcctggccacagaaagccctcccccgcccaagggaaccggccagagagtactgtgtcg
ttcaatccgtatgagccggaacttgggccctggactgcagaaaaaggcccccagagagaa
gcactgcccatggacacagaggtgtacgagagcccctacgcagaccccgaggagatcaga
cccaaggaggtttacctggatcgaagtctgctgacgctggaagacaaagaactgggctct
ggtaattttggaactgtgaaaaaaggctactaccaaatgaaaaaagctgatgatattgtt
gtgactttcagacatgtcaaggataagaacatcatagaactggttcatcaggtttctatg
ggcatgaagtatttggaggagagcaattttgtgcacagagatctggctgcaagaaatgtg
ttgctggttactcagcattatgccaagatcagtgattttggactttccaaagcgctgcgt
gctgatgagagctactacaaggcccagacccatgggaagtggcctgtcaagtggtacgct
ccggagtgtatcaactactacaagttctccagcaaaagtgacgtctggagctttggagtg
ttgatgtgggaagcattttcgtatgggcagaagccgtatcgtggaatgaaaggaagtgaa
gtcaccgcgatgttagagaagggagagcggatgggctgccctgcagggtgtccaagagag
atgtacgacctcatgaacctgtgctggacgtacgatgtggagaaccggcccggcttcgca
gcggtggaactgcggctgcgcaattactactatgacgtggtgaactaa

DBGET integrated database retrieval system