KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101031769
Entry
101031769         CDS       T04350                                 

Gene name
ADIPOQ
Definition
(RefSeq) adiponectin
  KO
K07296  adiponectin
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04152  AMPK signaling pathway
sbq04211  Longevity regulating pathway
sbq04920  Adipocytokine signaling pathway
sbq04930  Type II diabetes mellitus
sbq04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101031769 (ADIPOQ)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101031769 (ADIPOQ)
   03320 PPAR signaling pathway
    101031769 (ADIPOQ)
  09149 Aging
   04211 Longevity regulating pathway
    101031769 (ADIPOQ)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101031769 (ADIPOQ)
   04932 Non-alcoholic fatty liver disease
    101031769 (ADIPOQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sbq04990]
    101031769 (ADIPOQ)
Domain-containing proteins not elsewhere classified [BR:sbq04990]
 C1q domain-containing proteins
  Adiponectin / short collagen group proteins
   101031769 (ADIPOQ)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 101031769
NCBI-ProteinID: XP_003927045
UniProt: A0A2K6S3V1
LinkDB
Position
Unknown
AA seq 244 aa
MLLLGAVLLLLALPIRGQDTTDEEPGVLLPPPKGACTGWMAGIPGHPGHNGTPGRDGRDG
TPGEKGEKGDPGLIGPKGDTGETGVTGAEGPRGFPGMQGRKGEPGESAYVYRSAFSVGLE
TRVTVPNVPIRFTKIFYNLQSHYDGSTGKFHCNIPGLYYFSYHITVYMKDVKVSLFKKDK
AMLFTYDQYQDKNVDQASGSVLLHLDVGDQVWLQVYGEGEHNGLYADNVNDSTFTGFLLY
HDTD
NT seq 735 nt   +upstreamnt  +downstreamnt
atgctgctgctgggagctgttctactgctattagctttgcccattcgtggccaggatacc
acagacgaagagcccggagtcctgcttcctccacccaagggggcctgcacaggttggatg
gcaggcatcccagggcatccaggccataatgggaccccaggccgtgacggcagagatggc
acccctggcgagaagggtgagaaaggagatccaggtcttattggtcctaagggagacact
ggtgaaactggtgtaactggggccgaaggtcctcgaggctttccaggaatgcaaggcaga
aaaggggaacctggagaaagtgcgtatgtataccgctcagcattcagtgtgggattggag
acccgggttactgtccccaatgtgcccattcgctttaccaagatcttctacaatctgcaa
agccactatgatggctccactggtaagtttcactgcaacattcctgggctgtactacttc
tcctaccacatcacagtctatatgaaggatgtgaaggtcagcctcttcaagaaggacaaa
gctatgctcttcacctatgaccagtaccaggacaagaacgtggaccaggcctctggctca
gtactcctgcacctggatgtgggcgaccaagtctggctccaggtgtatggggaaggagag
cataatggactctatgctgataatgtcaatgactccaccttcacaggctttcttctctac
catgacaccgactga

DBGET integrated database retrieval system