KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101031838
Entry
101031838         CDS       T04350                                 

Gene name
FABP7
Definition
(RefSeq) fatty acid-binding protein, brain
  KO
K08756  fatty acid-binding protein 7, brain
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101031838 (FABP7)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7
Other DBs
NCBI-GeneID: 101031838
NCBI-ProteinID: XP_003922393
UniProt: A0A2K6SAD4
LinkDB
Position
Unknown
AA seq 132 aa
MVEAFCATWKLTDSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKN
TEISFHLGEEFDETTADDRNCKSVVSLDGDKLVHVQKWDGKETNFVREIKDGKMVMTLTF
GDVVAVRHYEKA
NT seq 399 nt   +upstreamnt  +downstreamnt
atggtggaggctttctgtgctacctggaaactgaccgacagtcagaactttgatgagtac
atgaaggctctaggtgtgggctttgccactaggcaggtgggaaatgtgaccaaaccaacg
gtaattatcagtcaggaaggagacaaagtggtcatcaggactctcagcacattcaagaac
acggagattagtttccacctgggagaagagtttgatgaaaccactgcggatgacagaaac
tgtaagtctgttgttagcctggatggagacaaacttgttcacgtacagaaatgggatggc
aaagaaacaaattttgtaagagaaattaaggatggcaaaatggttatgacccttactttt
ggtgatgtggttgctgttcgccactatgagaaggcataa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042765
Entry
101042765         CDS       T04350                                 

Gene name
FABP1
Definition
(RefSeq) fatty acid-binding protein, liver
  KO
K08750  fatty acid-binding protein 1, liver
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101042765 (FABP1)
  09154 Digestive system
   04975 Fat digestion and absorption
    101042765 (FABP1)
SSDB
Motif
Pfam: Lipocalin_7 Lipocalin Glyco_hydro_42M
Other DBs
NCBI-GeneID: 101042765
NCBI-ProteinID: XP_003942565
UniProt: A0A2K6SSC6
LinkDB
Position
Unknown
AA seq 127 aa
MNFTGKYQLQSQENFEPFMKAIGLPDELIQKGKDIKGVSEIVQNGKHFKLTITTGSKVIN
NEFTLGEECELETMTGEKVKAVVQMEGDNKLVTTFKNIKSVTELNGDIITSTMTLGNIVF
KRISKRI
NT seq 384 nt   +upstreamnt  +downstreamnt
atgaacttcaccggcaagtaccaactgcaaagccaggaaaactttgaacccttcatgaag
gcaatcggtctgccagacgagctcatccagaaggggaaggatatcaagggggtgtcagaa
atcgtgcagaatgggaagcacttcaagctcaccatcaccactgggtccaaagtgattaac
aacgagttcaccctgggagaggaatgtgagctggagacaatgacaggggagaaggtcaag
gcagtggttcagatggaaggtgacaataaactggtgacaactttcaaaaacatcaagtct
gtgaccgaactcaatggcgacataatcaccagtaccatgacattgggcaacattgtcttc
aagagaatcagcaagagaatttaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042952
Entry
101042952         CDS       T04350                                 

Gene name
FABP4
Definition
(RefSeq) fatty acid-binding protein, adipocyte
  KO
K08753  fatty acid-binding protein 4, adipocyte
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101042952 (FABP4)
   03320 PPAR signaling pathway
    101042952 (FABP4)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7 HSP20
Other DBs
NCBI-GeneID: 101042952
NCBI-ProteinID: XP_010349193
UniProt: A0A2K6SR27
LinkDB
Position
Unknown
AA seq 132 aa
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFKLGQEFDEITADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECIM
KGVTSTRVYERA
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtgtgatgcttttgtaggtacctggaaacttgtctccagtgaaaactttgatgattat
atgaaagaagtaggagtgggctttgccaccaggaaggtggctggcatggccaaacctaac
atgatcatcagtgtgaatggggatgtgattaccattaaatctgaaagcacctttaaaaat
actgagatttccttcaaactgggccaggaatttgacgaaattaccgcagatgacaggaaa
gtcaagagcaccataaccttagatggaggtgtcctggtacatgtgcagaaatgggatgga
aaatcaaccaccataaagagaaaacgagaggatgataaactggtggtggaatgcatcatg
aaaggcgtcacttccaccagagtttatgagagagcataa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043609
Entry
101043609         CDS       T04350                                 

Gene name
FABP5
Definition
(RefSeq) fatty acid-binding protein, epidermal
  KO
K08754  fatty acid-binding protein 5, epidermal
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101043609 (FABP5)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7 DUF1967
Other DBs
NCBI-GeneID: 101043609
NCBI-ProteinID: XP_003940229
UniProt: A0A2K6SLC8
LinkDB
Position
Unknown
AA seq 135 aa
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCILGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVDC
IMNNVTCTRIYEKVE
NT seq 408 nt   +upstreamnt  +downstreamnt
atggccacagttcagcagctggaaggaagatggcgcctggtggacagcaaaggctttgat
gaatacatgaaggaactaggagtgggaatagctttgagaaaaatgggcgcaatggccaag
ccagactgtatcatcacttgtgatggcaaaaacctcaccataaaaactgagagcacgttg
aaaacaacacagttttcttgtatcctgggagagaaatttgaagaaaccacagctgatggc
agaaaaactcagactgtctgcaactttacagatggtgccttggttcagcatcaggagtgg
gatgggaaggaaagcacaatcacaagaaaattgaaagatgggaaattagtggtggactgt
atcatgaacaatgtcacctgtactcggatctatgaaaaagtagaataa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045794
Entry
101045794         CDS       T04350                                 

Gene name
FABP2
Definition
(RefSeq) fatty acid-binding protein, intestinal
  KO
K08751  fatty acid-binding protein 2, intestinal
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101045794 (FABP2)
  09154 Digestive system
   04975 Fat digestion and absorption
    101045794 (FABP2)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7 Lipocalin_4
Other DBs
NCBI-GeneID: 101045794
NCBI-ProteinID: XP_010338650
LinkDB
Position
Unknown
AA seq 132 aa
MAFDGNWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNRFTVKESSTFRNIE
IVFELGVTFNYNLADGTELSGIWTLEGNKLTGKFKRIENGKELNTVREIIGGELVQIYVY
KGVEAKRIFKKD
NT seq 399 nt   +upstreamnt  +downstreamnt
atggcgtttgacggcaattggaaggtagaccggagtgaaaactatgacaagttcatggaa
aaaatgggtgttaatatagtgaaaaggaagcttgcagctcatgacaatttgaagctgaca
attacacaagaaggaaatagattcacagtcaaagaatcaagcacttttagaaacattgaa
attgtttttgaacttggtgtcacctttaattacaaccttgcagacggaactgaactctct
ggtatttggacccttgagggaaataaacttactggaaaattcaaaaggatagaaaatgga
aaagaactgaatactgtcagagaaattataggcggtgaactagtccagatttatgtatat
aaaggagtagaagccaaaagaatctttaaaaaggattga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047918
Entry
101047918         CDS       T04350                                 

Gene name
FABP6
Definition
(RefSeq) gastrotropin
  KO
K08755  fatty acid-binding protein 6, ileal (gastrotropin)
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101047918 (FABP6)
SSDB
Motif
Pfam: Lipocalin_7
Other DBs
NCBI-GeneID: 101047918
NCBI-ProteinID: XP_010343633
UniProt: A0A2K6T977
LinkDB
Position
Unknown
AA seq 128 aa
MAFTGKFEIESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYAGGRTM
TNKFTVGKESEIQTMGGKKFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEFSTIGSVTY
ERVSKRLA
NT seq 387 nt   +upstreamnt  +downstreamnt
atggctttcactggcaagttcgagatagagagtgagaagaattatgatgagttcatgaag
ctgctgggaatctccagcgatgtaatcgaaaaggcccgcaacttcaagatcgtcacggaa
gtgcagcaggatgggcaggacttcacttggtcccagcactacgccgggggccgcaccatg
accaacaagttcactgttggcaaggaaagcgagatacagacaatggggggcaagaagttc
aaggccactgtgcagatggagggtgggaagctggtggtgaatttccccaactatcaccag
acctcagagatcgtgggtgacaagctggtggagttctccaccatcggaagcgtgacctat
gagcgcgtgagcaagaggctggcctaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051224
Entry
101051224         CDS       T04350                                 

Gene name
FABP3
Definition
(RefSeq) fatty acid-binding protein, heart
  KO
K08752  fatty acid-binding protein 3, muscle and heart
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101051224 (FABP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101051224 (FABP3)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101051224 (FABP3)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7 DP-EP
Other DBs
NCBI-GeneID: 101051224
NCBI-ProteinID: XP_003937640
UniProt: A0A2K6T9H4
LinkDB
Position
Unknown
AA seq 133 aa
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTIILKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
NT seq 402 nt   +upstreamnt  +downstreamnt
atggtggacgctttcctgggcacctggaagctagtggacagcaagaatttcgatgactac
atgaagtcactcggtgtgggttttgctaccaggcaggtggccagcatgaccaagcctacc
acaatcattgaaaagaatggtgacactatcatcctaaaaacacacagcaccttcaagaac
acagagatcagctttaagctgggggtggaatttgatgagacaacagcagatgacaggaag
gtcaagtccattgtgacactggatggaggcaaacttgttcacctacagaagtgggacggg
caagagacgacacttgtgcgggagctaattgatggaaaactcatcctgacactcacccac
ggcactgcagtttgcactcgcacttatgagaaagaggcatga

DBGET integrated database retrieval system