KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101031846
Entry
101031846         CDS       T04350                                 

Gene name
PPARD
Definition
(RefSeq) peroxisome proliferator-activated receptor delta
  KO
K04504  peroxisome proliferator-activated receptor delta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04310  Wnt signaling pathway
sbq05200  Pathways in cancer
sbq05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101031846 (PPARD)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101031846 (PPARD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101031846 (PPARD)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101031846 (PPARD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101031846 (PPARD)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sbq03310]
    101031846 (PPARD)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    101031846 (PPARD)
Nuclear receptors [BR:sbq03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   101031846 (PPARD)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 101031846
NCBI-ProteinID: XP_003923229
UniProt: A0A2K6TSC0
LinkDB
Position
Unknown
AA seq 441 aa
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHPLPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSQ
HIYNAYLKNFNMTKKKARSILTGKASHTPPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPQVEAIQDTILRALEFHLQTNHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggagcagccacaggaggaagcccctgaggtccgggaagaggaggagaaagaggaagtg
gcagaggcagaaggagccccagagctcaatgggggaccacagcatccacttccttccagc
agctacacagacctctcccggagctcctctccaccctcactgctggaccagctgcagatg
ggctgtgacggggcctcgtgcggcagcctcaacatggagtgtcgggtgtgcggggacaag
gcctcgggcttccactacggcgttcatgcatgtgagggatgcaagggcttcttccgtcgg
acgatccgcatgaagctggagtacgagaagtgtgagcgcagctgcaagatccagaagaag
aaccgcaacaagtgccagtactgtcgcttccagaaatgcctggcactgggcatgtcccac
aacgctatccgttttggccggatgccagaggctgagaagaggaagctggtggcggggctg
acggcaaatgaggggagccagtacaacccacaggtggccgacctgaaggccttctcccag
cacatctacaatgcctacctgaaaaacttcaacatgaccaaaaagaaggcccgcagcatc
ctcacaggcaaagccagccacacgccgccctttgtgatccacgacatcgagacattgtgg
caggcggagaaggggctggtgtggaagcagctggtgaacggcctgccaccctacaaggaa
atcagcgtgcacgtcttctaccgctgccagtgcaccaccgtggagaccgtgcgggagctc
actgagttcgccaagagcatccccagcttcagcagcctcttcctcaacgaccaggtgacc
cttctcaaatacggcgtgcacgaggccatcttcgccatgctggcctccattgtcaacaag
gatgggctgctggtagccaacggcagtggctttgtcacccgtgagttcctgcgcagcctc
cgcaagcccttcagtgacatcattgagcccaagttcgaatttgctgtcaagttcaacgcc
ctggagcttgacgacagtgacctggccctgttcattgcggccatcattctgtgtggagac
cgaccaggcctcatgaacgtgccacaggtggaggccatccaggacaccatcctgcgtgcc
cttgaattccacctgcagaccaaccaccctgatgcccagtacctgttccccaagctgctg
cagaagatggctgacctccggcagctggtcaccgagcacgcccagatgatgcagcggatc
aagaagaccgagactgagacctcactgcaccccctgctgcaggaaatctacaaggacatg
tactaa

DBGET integrated database retrieval system