KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101031903
Entry
101031903         CDS       T04350                                 

Gene name
RBX1
Definition
(RefSeq) E3 ubiquitin-protein ligase RBX1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03420  Nucleotide excision repair
sbq04066  HIF-1 signaling pathway
sbq04110  Cell cycle
sbq04114  Oocyte meiosis
sbq04120  Ubiquitin mediated proteolysis
sbq04141  Protein processing in endoplasmic reticulum
sbq04310  Wnt signaling pathway
sbq04350  TGF-beta signaling pathway
sbq04710  Circadian rhythm
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101031903 (RBX1)
   04120 Ubiquitin mediated proteolysis
    101031903 (RBX1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    101031903 (RBX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101031903 (RBX1)
   04350 TGF-beta signaling pathway
    101031903 (RBX1)
   04066 HIF-1 signaling pathway
    101031903 (RBX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101031903 (RBX1)
   04114 Oocyte meiosis
    101031903 (RBX1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    101031903 (RBX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101031903 (RBX1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101031903 (RBX1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101031903 (RBX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101031903 (RBX1)
   03400 DNA repair and recombination proteins [BR:sbq03400]
    101031903 (RBX1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     101031903 (RBX1)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   101031903 (RBX1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     101031903 (RBX1)
   ECV complex
     101031903 (RBX1)
   Cul3 complex
     101031903 (RBX1)
   Cul4 complex
     101031903 (RBX1)
   Cul7 complex
     101031903 (RBX1)
   Cul9 complex
     101031903 (RBX1)
DNA repair and recombination proteins [BR:sbq03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      101031903 (RBX1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      101031903 (RBX1)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-C3HC4_3
Other DBs
NCBI-GeneID: 101031903
NCBI-ProteinID: XP_010341718
UniProt: A0A2K6T108
LinkDB
Position
Unknown
AA seq 105 aa
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQK
NT seq 318 nt   +upstreamnt  +downstreamnt
atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag
cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat
aactgtgccatctgcaggaaccacattatggatctttgcatagaatgtcaagctaaccag
gcatctgctacttcagaagagtgtaccgttgcatggggagtctgtaatcatgcttttcac
ttccactgcatctctcgctggctcaaaacacgacaggtgtgtccgttggacaacagagag
tgggaattccaaaagtag

DBGET integrated database retrieval system