KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032066
Entry
101032066         CDS       T04350                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04068  FoxO signaling pathway
sbq04110  Cell cycle
sbq04310  Wnt signaling pathway
sbq04350  TGF-beta signaling pathway
sbq04371  Apelin signaling pathway
sbq04390  Hippo signaling pathway
sbq04520  Adherens junction
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04659  Th17 cell differentiation
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05161  Hepatitis B
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05220  Chronic myeloid leukemia
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101032066 (SMAD4)
   04350 TGF-beta signaling pathway
    101032066 (SMAD4)
   04390 Hippo signaling pathway
    101032066 (SMAD4)
   04371 Apelin signaling pathway
    101032066 (SMAD4)
   04068 FoxO signaling pathway
    101032066 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101032066 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101032066 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    101032066 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101032066 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101032066 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101032066 (SMAD4)
   05212 Pancreatic cancer
    101032066 (SMAD4)
   05225 Hepatocellular carcinoma
    101032066 (SMAD4)
   05226 Gastric cancer
    101032066 (SMAD4)
   05220 Chronic myeloid leukemia
    101032066 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101032066 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101032066 (SMAD4)
   05161 Hepatitis B
    101032066 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 101032066
NCBI-ProteinID: XP_010335105
UniProt: A0A2K6U3T9
LinkDB
Position
Unknown
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgtg
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggaaaaaaaagatgaattggattctttaataacagcc
ataactacaaatggagctcatcctagtaaatgtgttaccatacagagaacattggatggg
agacttcaggtggctggccggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccatcaagtatgatggtgaaggat
gaatatgttcatgattttgagggacagccatcgttatccactgaaggacattcaattcaa
accatccagcatccaccaagtaatcgtgcgtcaacagagacatacagcaccccagctctg
ttagccccatctgagtctaatgctaccagcactgccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggggggcagccatagtgaaggactgttgcagata
gcatcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggaccgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggcctgttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccattgcttactttgaaatggatgttcaggtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatacgtggacccttctggaggagat
cgcttttgtttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagcgaccatgcggtctttgtacagagttactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cgtcagtgtcatcgacagatgcagcagcaggcggccactgcacaagctgcagcagctgcc
caggcagcagccgtggcaggaaacatccctggcccgggatcagtaggtggaatagctcca
gctatcagtctatcagctgctgctggaattggtgttgatgaccttcgtcgtttatgcata
ctcaggatgagttttgtgaaaggctggggaccggattacccaagacagagcatcaaagaa
acgccttgctggattgagattcacttacaccgtgccctccagctcctagatgaagtactt
cacaccatgccgattgcagacccacaacctttagactga

DBGET integrated database retrieval system