KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032105
Entry
101032105         CDS       T04350                                 

Gene name
GNAI3
Definition
(RefSeq) guanine nucleotide-binding protein G(k) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04015  Rap1 signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04360  Axon guidance
sbq04371  Apelin signaling pathway
sbq04540  Gap junction
sbq04611  Platelet activation
sbq04670  Leukocyte transendothelial migration
sbq04713  Circadian entrainment
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04727  GABAergic synapse
sbq04728  Dopaminergic synapse
sbq04730  Long-term depression
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04921  Oxytocin signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04924  Renin secretion
sbq04926  Relaxin signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04971  Gastric acid secretion
sbq05012  Parkinson disease
sbq05030  Cocaine addiction
sbq05032  Morphine addiction
sbq05034  Alcoholism
sbq05133  Pertussis
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05163  Human cytomegalovirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101032105 (GNAI3)
   04371 Apelin signaling pathway
    101032105 (GNAI3)
   04071 Sphingolipid signaling pathway
    101032105 (GNAI3)
   04024 cAMP signaling pathway
    101032105 (GNAI3)
   04022 cGMP-PKG signaling pathway
    101032105 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101032105 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101032105 (GNAI3)
   04670 Leukocyte transendothelial migration
    101032105 (GNAI3)
   04062 Chemokine signaling pathway
    101032105 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101032105 (GNAI3)
   04915 Estrogen signaling pathway
    101032105 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    101032105 (GNAI3)
   04921 Oxytocin signaling pathway
    101032105 (GNAI3)
   04926 Relaxin signaling pathway
    101032105 (GNAI3)
   04935 Growth hormone synthesis, secretion and action
    101032105 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    101032105 (GNAI3)
   04916 Melanogenesis
    101032105 (GNAI3)
   04924 Renin secretion
    101032105 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101032105 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    101032105 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101032105 (GNAI3)
   04727 GABAergic synapse
    101032105 (GNAI3)
   04725 Cholinergic synapse
    101032105 (GNAI3)
   04728 Dopaminergic synapse
    101032105 (GNAI3)
   04726 Serotonergic synapse
    101032105 (GNAI3)
   04730 Long-term depression
    101032105 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    101032105 (GNAI3)
  09158 Development and regeneration
   04360 Axon guidance
    101032105 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101032105 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101032105 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101032105 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    101032105 (GNAI3)
   05032 Morphine addiction
    101032105 (GNAI3)
   05034 Alcoholism
    101032105 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101032105 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101032105 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101032105 (GNAI3)
   05163 Human cytomegalovirus infection
    101032105 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101032105 (GNAI3)
   05142 Chagas disease
    101032105 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101032105 (GNAI3)
   04031 GTP-binding proteins [BR:sbq04031]
    101032105 (GNAI3)
Exosome [BR:sbq04147]
 Exosomal proteins
  Proteins found in most exosomes
   101032105 (GNAI3)
GTP-binding proteins [BR:sbq04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    101032105 (GNAI3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 101032105
NCBI-ProteinID: XP_003933458
UniProt: A0A2K6SZE1
LinkDB
Position
Unknown
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaagacaaggcggcagtggagcgaagcaagatgatcgac
cgcaacttacgggaggacggggagaaagcggccaaagaagtgaagctgctgctactcggt
gctggagaatctggtaaaagcaccattgtgaaacagatgaaaatcattcatgaggatggc
tattcagaggatgaatgtaaacaatataaagtagttgtctacagcaatactatacagtcc
atcattgcaatcatcagagccatgggacggctaaagattgactttggggaagctgccagg
gcagatgatgcccggcagttatttgttttagctggcagtgctgaagaaggagtcatgact
ccagaactagcaggagtgattaaacggttatggcgagatggcggggtacaagcttgcttc
agcagatccagggagtatcagctcaatgattctgcttcatattacctaaatgatctggat
agaatatctcaatctaactacattccaactcagcaagatgttcttcggacaagagtgaag
accacaggcattgtagaaacgcatttcaccttcaaagacctatacttcaagatgtttgac
gtaggtggccaaagatcagaacgaaaaaagtggattcactgttttgagggagtgacagca
attatcttctgtgtggccctcagtgattatgaccttgttctggctgaggatgaggagatg
aaccgaatgcatgaaagcatgaaactgtttgacagcatttgtaataacaaatggtttaca
gacacttcaatcattctcttccttaacaagaaagacctttttgaggaaaaaataaagaag
agtccattaactatctgttacccagaatacacaggttccaacacatatgaagaggcagct
gcctatattcaatgccagtttgaagatctgaacagaagaaaagataccaaggagatctat
actcacttcacctgtgccacagacacgaagaatgtgcagtttgtttttgatgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtggactttattga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101041681
Entry
101041681         CDS       T04350                                 

Gene name
GNAI2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2 isoform X1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04015  Rap1 signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04360  Axon guidance
sbq04371  Apelin signaling pathway
sbq04540  Gap junction
sbq04611  Platelet activation
sbq04670  Leukocyte transendothelial migration
sbq04713  Circadian entrainment
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04727  GABAergic synapse
sbq04728  Dopaminergic synapse
sbq04730  Long-term depression
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04921  Oxytocin signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04924  Renin secretion
sbq04926  Relaxin signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04971  Gastric acid secretion
sbq05012  Parkinson disease
sbq05030  Cocaine addiction
sbq05032  Morphine addiction
sbq05034  Alcoholism
sbq05133  Pertussis
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05163  Human cytomegalovirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101041681 (GNAI2)
   04371 Apelin signaling pathway
    101041681 (GNAI2)
   04071 Sphingolipid signaling pathway
    101041681 (GNAI2)
   04024 cAMP signaling pathway
    101041681 (GNAI2)
   04022 cGMP-PKG signaling pathway
    101041681 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101041681 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101041681 (GNAI2)
   04670 Leukocyte transendothelial migration
    101041681 (GNAI2)
   04062 Chemokine signaling pathway
    101041681 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101041681 (GNAI2)
   04915 Estrogen signaling pathway
    101041681 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    101041681 (GNAI2)
   04921 Oxytocin signaling pathway
    101041681 (GNAI2)
   04926 Relaxin signaling pathway
    101041681 (GNAI2)
   04935 Growth hormone synthesis, secretion and action
    101041681 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    101041681 (GNAI2)
   04916 Melanogenesis
    101041681 (GNAI2)
   04924 Renin secretion
    101041681 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101041681 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    101041681 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    101041681 (GNAI2)
   04727 GABAergic synapse
    101041681 (GNAI2)
   04725 Cholinergic synapse
    101041681 (GNAI2)
   04728 Dopaminergic synapse
    101041681 (GNAI2)
   04726 Serotonergic synapse
    101041681 (GNAI2)
   04730 Long-term depression
    101041681 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    101041681 (GNAI2)
  09158 Development and regeneration
   04360 Axon guidance
    101041681 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101041681 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101041681 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101041681 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    101041681 (GNAI2)
   05032 Morphine addiction
    101041681 (GNAI2)
   05034 Alcoholism
    101041681 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101041681 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101041681 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101041681 (GNAI2)
   05163 Human cytomegalovirus infection
    101041681 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101041681 (GNAI2)
   05142 Chagas disease
    101041681 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101041681 (GNAI2)
   04031 GTP-binding proteins [BR:sbq04031]
    101041681 (GNAI2)
Exosome [BR:sbq04147]
 Exosomal proteins
  Proteins found in most exosomes
   101041681 (GNAI2)
GTP-binding proteins [BR:sbq04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    101041681 (GNAI2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29
Other DBs
NCBI-GeneID: 101041681
NCBI-ProteinID: XP_003936686
UniProt: A0A2K6TVW1
LinkDB
Position
Unknown
AA seq 355 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLVICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggggtgcaccgtgagcgccgaggacaaggcggcggccgagcgctctaagatgatcgac
aagaacctgcgggaggacggcgagaaggcggcgcgggaggtgaagttgctgctgttgggt
gctggggagtcagggaagagcaccatcgtcaagcagatgaagatcatccacgaggatggc
tactccgaggaggaatgccggcagtaccgggcggttgtctacagcaacaccatccagtcc
atcatggccattgtcaaggccatgggcaacctgcagatcgacttcgccgacccctccaga
gcggatgatgccaggcagctgtttgcactgtcctgcactgctgaggagcagggcgtgctc
cctgatgacctgtccggcgtcatccggaggctctgggctgaccatggtgtgcaggcctgc
tttggccgctcgagggaataccagctcaacgactcagccgcctactacctgaatgacctg
gagcgcattgcacagagtgactacatccccacgcagcaagatgtgctacggacccgagta
aagaccacggggatcgtggagacacacttcaccttcaaggacttacacttcaagatgttt
gatgtgggtggtcagcggtctgagcgaaagaagtggatccactgctttgagggcgtcaca
gccatcatcttctgcgtagcattgagcgcctatgacttggtgctagctgaggacgaggag
atgaaccgcatgcatgagagcatgaagctattcgacagcatctgcaacaacaagtggttc
acagacacgtccatcatcctcttcctcaacaagaaggacctgttcgaggagaagatcaca
cacagtcccctggtcatctgcttccctgagtacacaggggccaacaagtatgatgaggca
gccagctacatccagagtaagtttgaggacctgaataagcgcaaagacaccaaggagatc
tacacgcacttcacgtgcgccaccgacaccaagaacgtgcagtttgtgtttgacgccgtc
accgacgtcattatcaagaacaacttgaaggactgcggcctcttctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042629
Entry
101042629         CDS       T04350                                 

Gene name
GNAI1
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04015  Rap1 signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04360  Axon guidance
sbq04371  Apelin signaling pathway
sbq04540  Gap junction
sbq04611  Platelet activation
sbq04670  Leukocyte transendothelial migration
sbq04713  Circadian entrainment
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04727  GABAergic synapse
sbq04728  Dopaminergic synapse
sbq04730  Long-term depression
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04921  Oxytocin signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04924  Renin secretion
sbq04926  Relaxin signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04971  Gastric acid secretion
sbq05012  Parkinson disease
sbq05030  Cocaine addiction
sbq05032  Morphine addiction
sbq05034  Alcoholism
sbq05133  Pertussis
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05163  Human cytomegalovirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101042629 (GNAI1)
   04371 Apelin signaling pathway
    101042629 (GNAI1)
   04071 Sphingolipid signaling pathway
    101042629 (GNAI1)
   04024 cAMP signaling pathway
    101042629 (GNAI1)
   04022 cGMP-PKG signaling pathway
    101042629 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101042629 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101042629 (GNAI1)
   04670 Leukocyte transendothelial migration
    101042629 (GNAI1)
   04062 Chemokine signaling pathway
    101042629 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101042629 (GNAI1)
   04915 Estrogen signaling pathway
    101042629 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    101042629 (GNAI1)
   04921 Oxytocin signaling pathway
    101042629 (GNAI1)
   04926 Relaxin signaling pathway
    101042629 (GNAI1)
   04935 Growth hormone synthesis, secretion and action
    101042629 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    101042629 (GNAI1)
   04916 Melanogenesis
    101042629 (GNAI1)
   04924 Renin secretion
    101042629 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101042629 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    101042629 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101042629 (GNAI1)
   04727 GABAergic synapse
    101042629 (GNAI1)
   04725 Cholinergic synapse
    101042629 (GNAI1)
   04728 Dopaminergic synapse
    101042629 (GNAI1)
   04726 Serotonergic synapse
    101042629 (GNAI1)
   04730 Long-term depression
    101042629 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    101042629 (GNAI1)
  09158 Development and regeneration
   04360 Axon guidance
    101042629 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101042629 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101042629 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101042629 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    101042629 (GNAI1)
   05032 Morphine addiction
    101042629 (GNAI1)
   05034 Alcoholism
    101042629 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101042629 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101042629 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101042629 (GNAI1)
   05163 Human cytomegalovirus infection
    101042629 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101042629 (GNAI1)
   05142 Chagas disease
    101042629 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101042629 (GNAI1)
   04031 GTP-binding proteins [BR:sbq04031]
    101042629 (GNAI1)
Exosome [BR:sbq04147]
 Exosomal proteins
  Proteins found in most exosomes
   101042629 (GNAI1)
GTP-binding proteins [BR:sbq04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    101042629 (GNAI1)
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 101042629
NCBI-ProteinID: XP_010343064
UniProt: A0A2K6U692
LinkDB
Position
Unknown
AA seq 302 aa
MKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAG
AAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQ
DVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDL
VLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAG
SNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCG
LF
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaaaattatccatgaagctggttattcagaagaggagtgtaaacaatacaaagcagtg
gtctacagtaacaccatccagtcaattattgctatcattagggccatggggaggttgaag
atagactttggtgactcagcccgggcggatgatgcgcgccaactctttgtgctagctgga
gctgctgaagaaggctttatgactgcagaacttgctggagttataaagagattgtggaaa
gatagtggtgtacaagcctgtttcaacagatcccgagagtaccagcttaatgattctgca
gcatactatttgaatgacttggacagaatagctcaaccaaattatatcccgactcaacaa
gatgttcttagaactagagtgaaaactacaggaattgttgaaacccattttactttcaaa
gatcttcattttaaaatgtttgatgtgggaggtcagcgatctgagcggaagaagtggatt
cattgcttcgaaggagtgacagcaatcatcttctgcgtagcactgagtgactacgacctg
gttctagctgaagatgaagaaatgaatcgaatgcatgaaagcatgaagctgtttgacagc
atatgtaacaacaagtggtttacagatacatctattatactttttctcaacaagaaggat
ctctttgaagaaaaaatcaaaaagagccctctcactatatgctatccagaatatgcagga
tcaaacacatatgaagaggcagctgcatatattcaatgtcagtttgaagacctcaataaa
agaaaagacacaaaggaaatttacacccacttcacatgtgccacagatactaagaatgtg
cagtttgtttttgatgctgtaacagatgtcatcataaaaaataatctaaaagattgcggt
ctcttctaa

DBGET integrated database retrieval system