KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032215
Entry
101032215         CDS       T04350                                 

Gene name
PPARA
Definition
(RefSeq) peroxisome proliferator-activated receptor alpha
  KO
K07294  peroxisome proliferator-activated receptor alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04024  cAMP signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04922  Glucagon signaling pathway
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101032215 (PPARA)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101032215 (PPARA)
   04920 Adipocytokine signaling pathway
    101032215 (PPARA)
   03320 PPAR signaling pathway
    101032215 (PPARA)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101032215 (PPARA)
   04931 Insulin resistance
    101032215 (PPARA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101032215 (PPARA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101032215 (PPARA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sbq03310]
    101032215 (PPARA)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    101032215 (PPARA)
Nuclear receptors [BR:sbq03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   101032215 (PPARA)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 101032215
NCBI-ProteinID: XP_003932800
UniProt: A0A2K6TIY9
LinkDB
Position
Unknown
AA seq 468 aa
MVDTESPLCPLSPLEAADLESPLSEEFLQEMGNIQEISQSIGEDSSGSFSFTEYQYLGSG
PGSDGSVITDTLSPASSPSSVTCPVVPSSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRTCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCDDDIEDSESADLKYLTKRIYEAYLKNFNMNKVKARLILAGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDS
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggtggacacagaaagcccgctctgccccctctccccactcgaggctgccgatctagag
agcccgttatctgaagaattcctgcaagaaatgggaaacatccaagagatttcacaatcc
attggtgaggatagttctggaagcttcagttttacggaataccagtacttaggaagcggt
cccggctcagatggctcggtcatcacggacacgctttcaccagcttcaagcccctcctca
gtgacttgccctgtggtcccgagcagcgtggacgagtctcccagtggagcactgaacatc
gaatgcagaatctgcggggacaaagcctcgggctaccattacggagtccacgcctgtgaa
ggctgcaagggcttctttcggcgaacgatccgactcaagctggtgtatgacaagtgtgat
cgcacctgtaagatccagaaaaagaatagaaacaagtgccagtattgtcgctttcacaag
tgcctttccgttgggatgtcacacaacgcgattcgttttggacgaatgccaagatctgaa
aaagcgaaactgaaagcagaaattcttacctgcgatgatgacatagaagattctgaaagc
gcagatctcaaatatctgaccaagagaatctacgaggcctacctgaagaacttcaacatg
aacaaggtcaaagcccggctcatcctggcaggaaaggccagtaacaacccaccttttgtc
atacatgatatggagaccctgtgtatggctgagaagacactggtggccaagctggtggcc
aatggcatccagaacaaggaggcagaggtccgcatcttccactgctgccagtgcacgtcg
gtggagaccgtcacggagctcacggaattcgccaaggccatcccaggcttcgcaaacttg
gacctgaacgatcaagtgacgctgctaaaatatggcgtttacgaggccatatttgcaatg
ctgtcttctgtgatgaacaaagacggcatgctggtagcatatggaaatgggtttataact
cgtgaattcctgaaaagcctgaggaaaccgttctgtgatatcatggagcccaagtttgat
tttgccatgaagttcaatgcactggaactggatgacagcgacatctccctcttcgtggct
gctatcatttgctgtggagatcgccctggccttctaaacgtaggacacattgaaaaaatg
caggagggtatcgtgcatgtgctcagactccacctgcagagcaaccacccggacgatagc
tttctcttcccgaaacttcttcaaaaaatggcggacctccggcagctggtcacggagcat
gcacagctggtgcagatcatcaagaagacggagtcggacgccgccctgcacccgctgctg
caggagatttacagggacatgtactga

DBGET integrated database retrieval system