KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032306
Entry
101032306         CDS       T04350                                 

Gene name
PTPN6
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 6 isoform X4
  KO
K05697  tyrosine-protein phosphatase non-receptor type 6 [EC:3.1.3.48]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04520  Adherens junction
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq05140  Leishmaniasis
sbq05205  Proteoglycans in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101032306 (PTPN6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101032306 (PTPN6)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101032306 (PTPN6)
   04660 T cell receptor signaling pathway
    101032306 (PTPN6)
   04662 B cell receptor signaling pathway
    101032306 (PTPN6)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101032306 (PTPN6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101032306 (PTPN6)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101032306 (PTPN6)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101032306 (PTPN6)
Protein phosphatases and associated proteins [BR:sbq01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    101032306 (PTPN6)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 101032306
NCBI-ProteinID: XP_003944917
UniProt: A0A2K6T2P4
LinkDB
Position
Unknown
AA seq 595 aa
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
ETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGG
SETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSSIPGSD
YINANYIKNQLLGPDENTKTYIASQGCLEATVNDFWQMAWQENTRVIVMTTREVEKGRSK
CVPYWPEVGTQRVYGPYSVTNCREHDTPEYKLRSLQVSPLDNGDLVREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQETLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNIT
YPPAMKNAHAKASRTSSKHKEDVYENLQGKNKREEKVKKQRSADKEKSKGSLKRK
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggtgaggtggtttcaccgagacctcagtgggctggatgcagagaccctgctcaagggc
cgaggcgtccatggcagcttcctggctcggcccagtcgcaagaaccagggtgacttctcg
ctctctgtcagggtgggggatcaggtgacccatattcggatccagaactcaggggatttc
tacgacctgtatggaggggagaagtttgccacgctgacggagctggtggagtactacact
cagcagcagggcgtcctgcaggatcgcgacggcaccatcatccacctcaagtacccgctg
aactgctccgaccccactagtgagaggtggtaccatggtcacatgtctggagggcaggca
gagacactgcttcaggccaagggcgagccttggacgtttcttgtgcgtgagagcctcagc
cagcctggagactttgtgctgtccgtgctcagtgaccagcccaaggctggcccaggctcc
ccgctcagggtcacccacatcaaggtcatgtgtgagggtggacgctacacggtgggtggt
tcagagacctttgatagcctcacggacctggtggagcatttcaagaagacggggattgag
gaggcctcaggcgcctttgtctacctgcggcagccgtactacgccacgagggtgaatgcg
gccgacattgagaaccgagtcttggaactgaacaagaagcaggagtccgaggacacagcc
aaggctggcttctgggaggagtttgagagtctgcagaagcaggaggtgaagaacttgcac
cagcgcctggaaggacagcggccagagaacaagggcaagaaccgctacaagaacattctc
ccttttgaccacagccgagtgatcctgcagggacgtgacagtagcatccctgggtctgac
tacatcaatgcaaactacatcaagaaccagctgctaggccctgatgagaacactaagacc
tatatcgccagccagggctgtctggaggccacggtcaacgacttctggcagatggcgtgg
caggagaacacccgtgtcatcgtcatgaccacccgagaggtggagaaaggccggagcaaa
tgtgtcccctactggcccgaggtgggcactcagcgcgtttatgggccctactctgtgacc
aactgcagggagcacgacacgcccgaatataaactccgcagcttacaggtctccccactg
gacaatggggacctggttcgggagatctggcactaccagtacctgagctggcccgaccat
ggggtccccagtgagcccgggggcgtcctcagcttcctggaccagatcaaccagcggcag
gagaccctgccccacgcgggccccatcatcgtgcactgcagcgcgggcattggccgcaca
ggtaccatcatagtcatcgacatgctcatggagaacatctccaccaagggcctggactgt
gacattgacatccagaagaccatccagatggtgcgggcccagcgctcgggcatggtgcag
acggaggcgcagtacaagttcatctacgtggccatcgcccagttcattgaaaccaccaag
aagaagctggaggtcctgcagtcgcagaagggccaggagtcagagtacgggaacatcacc
taccccccagccatgaagaacgcccatgccaaggcctcccgcacgtcatccaaacacaag
gaagacgtgtatgagaacctgcaggggaagaacaagcgcgaggagaaggtgaagaagcag
cggtcagcagacaaggagaagagcaagggctccctcaagaggaagtga

DBGET integrated database retrieval system