KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032308
Entry
101032308         CDS       T04350                                 

Definition
(RefSeq) interferon alpha-8-like
  KO
K05414  interferon alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101032308
   04151 PI3K-Akt signaling pathway
    101032308
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101032308
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101032308
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101032308
   04621 NOD-like receptor signaling pathway
    101032308
   04622 RIG-I-like receptor signaling pathway
    101032308
   04623 Cytosolic DNA-sensing pathway
    101032308
   04650 Natural killer cell mediated cytotoxicity
    101032308
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101032308
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101032308
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101032308
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101032308
   05161 Hepatitis B
    101032308
   05160 Hepatitis C
    101032308
   05171 Coronavirus disease - COVID-19
    101032308
   05164 Influenza A
    101032308
   05162 Measles
    101032308
   05168 Herpes simplex virus 1 infection
    101032308
   05163 Human cytomegalovirus infection
    101032308
   05167 Kaposi sarcoma-associated herpesvirus infection
    101032308
   05169 Epstein-Barr virus infection
    101032308
   05165 Human papillomavirus infection
    101032308
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101032308
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101032308
SSDB
Motif
Pfam: Interferon DUF4164 DDHD UPF0058
Other DBs
NCBI-GeneID: 101032308
NCBI-ProteinID: XP_003928165
LinkDB
Position
Unknown
AA seq 185 aa
MMVLPLYLLVALLVLSYKSFSSLGCDLPQNYSLGNRRALVFLAQMRRISPFSCLKDRHDF
GFPPKEFDGSKLQKAQAIFVLHEMIQQIFNLFSTKDSSAAWDETLLEKFYTELHQQLNDL
EACVMQKAGVTETPVMYEDFILAVRKYFQRIALYLTEKKHSPCAWEVVRAEIMRSFSLLT
NLQKR
NT seq 558 nt   +upstreamnt  +downstreamnt
atgatggtcttgcccttgtatttactggtggcccttctggtgctcagctacaagtcattc
agctctctgggctgtgatctgcctcagaactacagcttgggtaacaggagggccttggta
tttctggcacaaatgagaagaatctctcctttttcctgcctgaaggacagacatgacttt
ggattccccccgaaggagtttgatggcagcaagctccagaaggcgcaagccatttttgtc
ctccatgagatgatccagcagatcttcaacctcttcagcacaaaggactcatctgcagct
tgggacgagaccctccttgaaaaattctacactgaacttcaccagcagctgaatgatcta
gaagcctgtgtgatgcagaaggcaggggtgacagagactcccgtgatgtacgaggacttc
attctggctgtgaggaaatacttccaaagaattgctctatatctgacagagaagaaacac
agcccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttattgacc
aacttgcaaaaaagatag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032622
Entry
101032622         CDS       T04350                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101032622
   04151 PI3K-Akt signaling pathway
    101032622
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101032622
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101032622
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101032622
   04621 NOD-like receptor signaling pathway
    101032622
   04622 RIG-I-like receptor signaling pathway
    101032622
   04623 Cytosolic DNA-sensing pathway
    101032622
   04650 Natural killer cell mediated cytotoxicity
    101032622
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101032622
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101032622
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101032622
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101032622
   05161 Hepatitis B
    101032622
   05160 Hepatitis C
    101032622
   05171 Coronavirus disease - COVID-19
    101032622
   05164 Influenza A
    101032622
   05162 Measles
    101032622
   05168 Herpes simplex virus 1 infection
    101032622
   05163 Human cytomegalovirus infection
    101032622
   05167 Kaposi sarcoma-associated herpesvirus infection
    101032622
   05169 Epstein-Barr virus infection
    101032622
   05165 Human papillomavirus infection
    101032622
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101032622
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101032622
SSDB
Motif
Pfam: Interferon CBF
Other DBs
NCBI-GeneID: 101032622
NCBI-ProteinID: XP_003928166
LinkDB
Position
Unknown
AA seq 189 aa
MALTFPFLVALVLLSYKSSCSMGCDLPQTHSLGNRRTLMLLAQMRRISPFSCLKDRHDFE
FPQEEFDGSQLQKARAIFVLHEMIQQTFNLFSTKDSSAAWDETLLDKFYTELYQQLNELE
ACVMQEVGVTDTPLMNEDSILTVRKYFQRITLYLKEKKYSACAWEVVRAEIMRSFSSSTN
LQKALRSKK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgacctttcctttcctggtggccctcgtgctgctcagctacaagtcaagctgc
tctatgggctgtgatctgcctcaaacccacagcctgggtaacaggagaactttgatgctt
ctggcacaaatgaggagaatctctcctttctcctgcctgaaggacagacatgactttgaa
tttccccaggaggagtttgatggcagccagctccagaaggctagagccatttttgtcctc
catgagatgatccagcagaccttcaacctcttcagcacaaaagactcatctgctgcttgg
gatgagaccctcctagacaaattctacactgaactttaccagcagctgaatgaattggaa
gcctgtgtgatgcaggaggtgggggtgacagatactcccctgatgaatgaggactccatc
ctgactgtgaggaaatatttccaaagaatcactctctatctgaaagagaagaaatacagc
gcttgtgcctgggaggttgtcagagcagaaataatgagatctttttcttcatcaacaaac
ttgcaaaaagctttaagaagtaagaaatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032943
Entry
101032943         CDS       T04350                                 

Gene name
IFNA13
Definition
(RefSeq) interferon alpha-1/13
  KO
K05414  interferon alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101032943 (IFNA13)
   04151 PI3K-Akt signaling pathway
    101032943 (IFNA13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101032943 (IFNA13)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101032943 (IFNA13)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101032943 (IFNA13)
   04621 NOD-like receptor signaling pathway
    101032943 (IFNA13)
   04622 RIG-I-like receptor signaling pathway
    101032943 (IFNA13)
   04623 Cytosolic DNA-sensing pathway
    101032943 (IFNA13)
   04650 Natural killer cell mediated cytotoxicity
    101032943 (IFNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101032943 (IFNA13)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101032943 (IFNA13)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101032943 (IFNA13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101032943 (IFNA13)
   05161 Hepatitis B
    101032943 (IFNA13)
   05160 Hepatitis C
    101032943 (IFNA13)
   05171 Coronavirus disease - COVID-19
    101032943 (IFNA13)
   05164 Influenza A
    101032943 (IFNA13)
   05162 Measles
    101032943 (IFNA13)
   05168 Herpes simplex virus 1 infection
    101032943 (IFNA13)
   05163 Human cytomegalovirus infection
    101032943 (IFNA13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101032943 (IFNA13)
   05169 Epstein-Barr virus infection
    101032943 (IFNA13)
   05165 Human papillomavirus infection
    101032943 (IFNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101032943 (IFNA13)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101032943 (IFNA13)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 101032943
NCBI-ProteinID: XP_003928167
LinkDB
Position
Unknown
AA seq 189 aa
MALPFPSLMALVVLSCKISCYLTCDLPQIHSLDNRRTMMLLAQMMRIFPFSCWKDRHDFG
FPQEEFDGNQFQKAPAIFVLHEMIQQTFNLFTTEDSSAAWDKDLLDELCTELYRQLNDLE
ACVMEEERAGETPLMNVDSILAVKKYFRRITLYLTEKKYSPCAWEVVRVEIMRSFSLSKN
LLERLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgccctttccttcactgatggccctggtggtgctcagctgcaagataagctgc
tatctgacctgtgatctgcctcagatccatagcctggataacaggaggaccatgatgctc
ctggcacaaatgatgagaatctttcctttttcctgttggaaggacagacatgactttgga
tttccccaggaggagtttgatggcaaccagtttcagaaggcaccagccatctttgtcctc
catgagatgatccagcagacctttaacctctttaccacagaagactcatctgctgcttgg
gataaggacctcctagatgaactctgcactgaactctaccggcagctaaatgacttggaa
gcctgtgtgatggaggaggagagggcgggagaaactcccctgatgaatgtggactccatc
ttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc
ccttgtgcctgggaagttgtcagagtagaaatcatgagatccttctctttatcaaaaaac
ttactagaaagattaaggaggaaggattaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034105
Entry
101034105         CDS       T04350                                 

Definition
(RefSeq) interferon alpha-8-like
  KO
K05414  interferon alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101034105
   04151 PI3K-Akt signaling pathway
    101034105
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101034105
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101034105
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101034105
   04621 NOD-like receptor signaling pathway
    101034105
   04622 RIG-I-like receptor signaling pathway
    101034105
   04623 Cytosolic DNA-sensing pathway
    101034105
   04650 Natural killer cell mediated cytotoxicity
    101034105
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034105
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101034105
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101034105
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101034105
   05161 Hepatitis B
    101034105
   05160 Hepatitis C
    101034105
   05171 Coronavirus disease - COVID-19
    101034105
   05164 Influenza A
    101034105
   05162 Measles
    101034105
   05168 Herpes simplex virus 1 infection
    101034105
   05163 Human cytomegalovirus infection
    101034105
   05167 Kaposi sarcoma-associated herpesvirus infection
    101034105
   05169 Epstein-Barr virus infection
    101034105
   05165 Human papillomavirus infection
    101034105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101034105
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101034105
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 101034105
NCBI-ProteinID: XP_003928170
LinkDB
Position
Unknown
AA seq 190 aa
MMVLSLHLLVALLVLSYKSFSSLGCDLPQNYSLGNRRALVFLAQMRRISPFSCLKDRHDF
GFPQKEFDGSKLQKAQAIFVLHEMVQQTFNLFSTKDSSAAWDETLLEKFYTELHQQLNDL
EACAMQKVGVTETPLMYEDFILAVRKYFQRIILYLIEKKHSPCAWEVVRAEIMRSFSLLT
NLQKRSKTKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atgatggtcttgtccttacatttactggtggcccttctggtgctcagctacaagtcattc
agctctctgggctgtgatctgcctcagaactacagcttgggtaacaggagggccttggta
ttcctggcacaaatgagaagaatctctcctttctcctgcctgaaggacagacatgacttt
ggattcccccaaaaggagtttgatggcagcaagctccagaaggctcaggccatttttgtc
ctccatgagatggtccagcagaccttcaacctcttcagtacaaaggactcatctgcagct
tgggacgagaccctccttgaaaaattctacactgaacttcaccagcagctgaatgatctg
gaagcctgtgcaatgcagaaggtaggggtgacagagactcccctgatgtacgaggacttc
attttggctgtgaggaaatacttccaaagaatcattctatacctgatagagaagaaacac
agcccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttattgacc
aacttgcaaaaaagatcgaagactaaggaatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034416
Entry
101034416         CDS       T04350                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101034416
   04151 PI3K-Akt signaling pathway
    101034416
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101034416
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101034416
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101034416
   04621 NOD-like receptor signaling pathway
    101034416
   04622 RIG-I-like receptor signaling pathway
    101034416
   04623 Cytosolic DNA-sensing pathway
    101034416
   04650 Natural killer cell mediated cytotoxicity
    101034416
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034416
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101034416
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101034416
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101034416
   05161 Hepatitis B
    101034416
   05160 Hepatitis C
    101034416
   05171 Coronavirus disease - COVID-19
    101034416
   05164 Influenza A
    101034416
   05162 Measles
    101034416
   05168 Herpes simplex virus 1 infection
    101034416
   05163 Human cytomegalovirus infection
    101034416
   05167 Kaposi sarcoma-associated herpesvirus infection
    101034416
   05169 Epstein-Barr virus infection
    101034416
   05165 Human papillomavirus infection
    101034416
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101034416
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101034416
SSDB
Motif
Pfam: Interferon CBF DUF4164
Other DBs
NCBI-GeneID: 101034416
NCBI-ProteinID: XP_003928171
LinkDB
Position
Unknown
AA seq 189 aa
MALPFTLLMALVVLSCKSICSLGCDLPQAHSLNNRRALILLAQMRRISPFSCLKDRQDFV
FPQEVFDGDHFQKAQAIFILHEMIQQTFNLFSTKDSSATWDATLLDKFYTELYEQLNDLE
TCVMQRIGVEETPLAYEDSILAVRKYFQRITLYLTEKKHSLCAWEVVRAEIMRSFSLLTD
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgccctttactttactgatggccctagtggtgctcagctgcaagtccatctgc
tctctgggctgtgatctgcctcaggcccatagcctgaataacagaagggccttgatactc
ctggcacaaatgaggagaatctctcctttctcttgcctgaaggacagacaggactttgtt
ttccctcaagaggtgtttgatggtgaccacttccagaaggctcaagctatcttcatcctc
catgagatgatccagcagaccttcaacctctttagcacaaaggactcatccgctacttgg
gatgcaacccttttagataaattttacactgaactttacgagcagctgaatgacttggaa
acctgtgtgatgcagaggattggagtggaagagactcccttggcgtatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctctatctgacagagaagaaacacagc
ctttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttattgaccgac
ttgcaagaaagattaagaaggaaggaatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034728
Entry
101034728         CDS       T04350                                 

Gene name
IFNA21
Definition
(RefSeq) interferon alpha-21
  KO
K05414  interferon alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101034728 (IFNA21)
   04151 PI3K-Akt signaling pathway
    101034728 (IFNA21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101034728 (IFNA21)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101034728 (IFNA21)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101034728 (IFNA21)
   04621 NOD-like receptor signaling pathway
    101034728 (IFNA21)
   04622 RIG-I-like receptor signaling pathway
    101034728 (IFNA21)
   04623 Cytosolic DNA-sensing pathway
    101034728 (IFNA21)
   04650 Natural killer cell mediated cytotoxicity
    101034728 (IFNA21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034728 (IFNA21)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101034728 (IFNA21)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101034728 (IFNA21)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101034728 (IFNA21)
   05161 Hepatitis B
    101034728 (IFNA21)
   05160 Hepatitis C
    101034728 (IFNA21)
   05171 Coronavirus disease - COVID-19
    101034728 (IFNA21)
   05164 Influenza A
    101034728 (IFNA21)
   05162 Measles
    101034728 (IFNA21)
   05168 Herpes simplex virus 1 infection
    101034728 (IFNA21)
   05163 Human cytomegalovirus infection
    101034728 (IFNA21)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101034728 (IFNA21)
   05169 Epstein-Barr virus infection
    101034728 (IFNA21)
   05165 Human papillomavirus infection
    101034728 (IFNA21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101034728 (IFNA21)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101034728 (IFNA21)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 101034728
NCBI-ProteinID: XP_003928172
LinkDB
Position
Unknown
AA seq 189 aa
MALSFSLLMTMVVLSCKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRSDFE
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKASYAAWEQSLLEKFSNELYQQLNDLE
ACVIQEVGVEETPLMNADSILAVRKYFQRITLYLTKKKYSPCGWEVVRAEIMRSFSLSTN
LRERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctttgtccttttctttactgatgaccatggtggtgctcagctgcaaatccatctgc
tctcttggctgtgatctgcctcagacccacagcctgggtaacaggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagaagtgactttgaa
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagactttcaatctcttcagcacaaaagcctcatatgctgcttgg
gaacagagtcttctagagaaattttccaatgaactttaccagcagttgaatgatctggaa
gcctgtgtaatacaggaggttggggtggaagagactcccctgatgaatgcagactccatc
ctggctgtgaggaaatacttccaaagaatcactctttatctgacaaagaagaaatacagc
ccttgtggctgggaggtggtcagagcagaaatcatgagatccttctctttatcaacaaac
ttgcgagaaagattaaggaggaaggaatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035681
Entry
101035681         CDS       T04350                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta
  KO
K05415  interferon beta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04380  Osteoclast differentiation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04668  TNF signaling pathway
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101035681 (IFNB1)
   04668 TNF signaling pathway
    101035681 (IFNB1)
   04151 PI3K-Akt signaling pathway
    101035681 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101035681 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101035681 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101035681 (IFNB1)
   04621 NOD-like receptor signaling pathway
    101035681 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    101035681 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    101035681 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    101035681 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101035681 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101035681 (IFNB1)
   05152 Tuberculosis
    101035681 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101035681 (IFNB1)
   05161 Hepatitis B
    101035681 (IFNB1)
   05160 Hepatitis C
    101035681 (IFNB1)
   05171 Coronavirus disease - COVID-19
    101035681 (IFNB1)
   05164 Influenza A
    101035681 (IFNB1)
   05162 Measles
    101035681 (IFNB1)
   05168 Herpes simplex virus 1 infection
    101035681 (IFNB1)
   05163 Human cytomegalovirus infection
    101035681 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101035681 (IFNB1)
   05169 Epstein-Barr virus infection
    101035681 (IFNB1)
   05165 Human papillomavirus infection
    101035681 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101035681 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101035681 (IFNB1)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   101035681 (IFNB1)
SSDB
Motif
Pfam: Interferon MetOD1
Other DBs
NCBI-GeneID: 101035681
NCBI-ProteinID: XP_003928175
LinkDB
Position
Unknown
AA seq 185 aa
MTHKCLLQIALLLCFSTTAISMSYNLLGFLQRRSNFQSQKLLRQLNGRLEYCLKDRMDFE
IPKEITQPQRLQKEDVALIVYEMLQNIFTIFNRDFSRTGWNKTIVENFLANVYQHIEHLK
TILKEKWEKKEFTREKSMSSLHLKRYYGRILHYLMAKEYSHCAWTIVSAEILRNFYFIDR
LTGYL
NT seq 558 nt   +upstreamnt  +downstreamnt
atgacccacaagtgtctcctccaaattgctctcctgttgtgcttctccactacagctatt
tccatgagctacaacttacttggattcctacaaagaagaagcaattttcagagccagaag
ctcctacggcaactgaatggaaggcttgaatattgcctcaaggacaggatggactttgag
atccctaaggagatcacacaaccgcagcggctccagaaggaggacgtggcattaatcgtc
tatgagatgctccagaacatttttactattttcaatagagatttctctaggactggctgg
aataagactattgttgagaacttccttgctaatgtctatcagcacatagaacatttgaag
acaatcctgaaagaaaaatgggagaaaaaagaattcaccagggaaaaatccatgagcagt
ctacacctgaaaagatattatgggaggattctgcattacctgatggccaaggagtacagc
cactgtgcctggaccatagtcagtgcggaaatcctcaggaacttttactttattgacaga
cttacaggttacctctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 104649849
Entry
104649849         CDS       T04350                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104649849
   04151 PI3K-Akt signaling pathway
    104649849
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104649849
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104649849
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104649849
   04621 NOD-like receptor signaling pathway
    104649849
   04622 RIG-I-like receptor signaling pathway
    104649849
   04623 Cytosolic DNA-sensing pathway
    104649849
   04650 Natural killer cell mediated cytotoxicity
    104649849
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104649849
  09163 Immune disease
   05320 Autoimmune thyroid disease
    104649849
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104649849
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104649849
   05161 Hepatitis B
    104649849
   05160 Hepatitis C
    104649849
   05171 Coronavirus disease - COVID-19
    104649849
   05164 Influenza A
    104649849
   05162 Measles
    104649849
   05168 Herpes simplex virus 1 infection
    104649849
   05163 Human cytomegalovirus infection
    104649849
   05167 Kaposi sarcoma-associated herpesvirus infection
    104649849
   05169 Epstein-Barr virus infection
    104649849
   05165 Human papillomavirus infection
    104649849
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    104649849
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interferons
   104649849
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 104649849
NCBI-ProteinID: XP_010337022
LinkDB
Position
Unknown
AA seq 111 aa
MALPFTLLMALVLCSCFLGCDLPQTHILDNRRTTVLLAQMRRISPFSCLKDRHDFEFPQE
EFDDKPFQKAQANSVHEMIQQIFNLFSTKDSSAPWDETLLLGMRLLNSSYE
NT seq 336 nt   +upstreamnt  +downstreamnt
atggccttgccctttactttactgatggccctagtgctatgcagctgttttctgggctgt
gatctgcctcagacccacatcctggataacaggaggaccacagtcctcctggctcaaatg
aggagaatctctcctttctcttgtctgaaggacagacatgactttgaatttccccaggag
gagtttgatgacaaaccgttccaaaaggctcaagccaactctgtccatgagatgatccag
cagatcttcaacctctttagcacaaaggactcatctgctccttgggatgagaccctgctg
cttgggatgagactactgaactctagttatgaatga

DBGET integrated database retrieval system