KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032312
Entry
101032312         CDS       T04350                                 

Gene name
EGR2
Definition
(RefSeq) E3 SUMO-protein ligase EGR2 isoform X1
  KO
K12496  early growth response protein 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04625  C-type lectin receptor signaling pathway
sbq05161  Hepatitis B
sbq05166  Human T-cell leukemia virus 1 infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101032312 (EGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101032312 (EGR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101032312 (EGR2)
   05161 Hepatitis B
    101032312 (EGR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101032312 (EGR2)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    101032312 (EGR2)
SSDB
Motif
Pfam: DUF3446 zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2HC_2 zf-BED zf-H2C2_5
Other DBs
NCBI-GeneID: 101032312
NCBI-ProteinID: XP_003928738
LinkDB
Position
Unknown
AA seq 486 aa
MRVGLPSEASSCPWSARGPRDPPERRRSGLAHVLSDNIYPVEDLAATSVTIFPNAELGGP
FDQMNGVAGDGMINIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASC
YPEGIINIVSAGILQGVTSPASTTASSNVTSASPNPLATGPLGVCTMSQTQPDLDHLYSP
PPPPPPYSGCAGDLYQDPSAFLSAATTSTSSSLAYPPPPSYPSPKPATDPGLFPMIPDYP
GFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASG
GSEGPRLPGSSSVAAAATAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRR
FSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARS
DERKRHTKIHLRQKERKSSAPSASLPAPSTASCSGGAQPGGTLCSSNSSTLGGGPLAPCS
SRTRTP
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgcgagtcggactcccctccgaggcgtcgtcttgcccatggtcagcgcgggggccgcgg
gacccgccggagcgcaggcggagcgggctggcgcacgtgctgtctgacaacatctacccg
gtggaggacctcgccgccacgtcggtgaccatctttcccaatgccgaactgggaggcccc
tttgaccagatgaacggagtggccggagatggcatgatcaacattgacatgactggagag
aagaggtcgttggatctcccatatcccagcagctttgctcctgtctctgcacccagaaac
cagaccttcacttacatgggcaaattctccattgaccctcagtaccctggtgccagctgc
tacccagaaggcatcatcaatattgtgagtgcaggcatcttacaaggggtcacctcccca
gcttcgaccacagcctcgtccaacgtcacgtctgcctcccccaacccactggccacagga
cccctgggtgtgtgcaccatgtcccagacccagcctgacctggaccacctgtactctccg
ccaccgcctcctcctccttattctggctgtgcaggagacctctaccaggacccttctgca
ttcctgtcagcagccaccacctccacctcttcctctctggcctacccaccacctccttcc
tacccgtcccccaagccagccacggacccaggtctcttcccgatgatcccagactatcct
ggattctttccatctcagtgccagagagacctacatggtacagctggcccagaccgtaag
ccctttccctgcccactggacacccttcgggtgccccctccactcactccactctcaacc
atccgtaactttaccctggggggccccagtgctggggtgactggaccaggggccagtgga
ggcagcgagggaccccggctgcctggtagcagctcagtagcagctgctgccactgcctat
aacccacaccacctgccactgcggcccattctgaggcctcgcaagtaccccaacagacct
agcaagacgccagtacatgaaaggccctacccatgcccagcagaaggctgtgaccggcgg
ttctcccgctccgacgagctgacacggcacatccgaatccacacggggcataagcccttc
cagtgtcggatctgcatgcgcaacttcagccgcagcgaccacctcaccacccatatccgc
acccacactggtgagaagccctttgcctgtgactactgtggccgaaagtttgcccggagt
gatgagaggaagcgccacaccaagatccacctgagacagaaagagcggaaaagcagtgcc
ccctctgcatcactgccagccccctccactgcgtcctgctctgggggcgcacagcctggg
ggtaccctgtgcagcagcaacagcagcactcttggtggagggccactggccccttgctcc
tctcggacccggacaccttga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047091
Entry
101047091         CDS       T04350                                 

Gene name
EGR3
Definition
(RefSeq) early growth response protein 3 isoform X2
  KO
K12497  early growth response protein 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04625  C-type lectin receptor signaling pathway
sbq05161  Hepatitis B
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101047091 (EGR3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101047091 (EGR3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101047091 (EGR3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101047091 (EGR3)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    101047091 (EGR3)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 DUF3446 zf-C2HC_2 zf-BED zf-H2C2_5 zf-C2H2_6
Other DBs
NCBI-GeneID: 101047091
NCBI-ProteinID: XP_003937215
UniProt: A0A2K6S5L6
LinkDB
Position
Unknown
AA seq 349 aa
MEPCAAWSPRGGRENVMDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWC
QDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPV
SFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPI
RVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACP
AEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFC
GRKFARSDERKRHAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVTTCA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggagccatgtgcggcgtggagtccccgcggtgggagagagaatgtaatggacatcggt
ctgaccaacgagaagcccaacccggaactctcttactccggctccttccagccagcccca
ggcaacaagaccgtgacctacttgggaaagttcgccttcgattccccttccaactggtgc
caggacaacatcattagcctcatgagcgccggcatcttgggggtgcccccggcttcaggg
gcgctcagcacgcagacgtccacggccagcatggtgcagccaccgcagggcgacgtggag
gccatgtatccggcgctacccccctactccaactgcggcgacctctactcagagcccgtg
tctttccacgacccccagggcaaccccgggctcgcctattctccccaggattaccaatcg
gccaagccggcgttggacagcaatctcttccccatgattcctgactacaacctgtaccac
caccccaacgacatgggctccattccggagcacaagcccttccagggcatggaccccatc
cgggtcaacccgccccctattacccctctggagaccatcaaggcgttcaaagacaagcag
atccacccgggctttggcagcctgccccagccgccgctcaccctcaagcccatccggccc
cgcaagtaccccaaccggcctagcaagaccccgctccacgaacggccccacgcgtgcccg
gccgagggctgcgaccgccgtttcagccgttcggacgagctgacccggcacctgcgcatc
cacacgggccacaagcccttccaatgccggatctgcatgcggagcttcagccgcagcgac
cacctcaccactcacatccgcactcatacgggcgagaagccctttgcctgcgagttctgt
gggcgcaagtttgcgcgcagcgacgagcgcaagcgccacgccaagatccacctcaagcaa
aaggagaagaaggcggagaagggcggtgcgccctctgcatcctcggcgccccccgtgtcg
ctggcccccgtggtcaccacctgcgcctga

DBGET integrated database retrieval system