KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032494
Entry
101032494         CDS       T04350                                 

Definition
(RefSeq) aldehyde oxidase 2
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00280  Valine, leucine and isoleucine degradation
sbq00350  Tyrosine metabolism
sbq00380  Tryptophan metabolism
sbq00750  Vitamin B6 metabolism
sbq00760  Nicotinate and nicotinamide metabolism
sbq00830  Retinol metabolism
sbq00982  Drug metabolism - cytochrome P450
sbq01100  Metabolic pathways
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101032494
   00350 Tyrosine metabolism
    101032494
   00380 Tryptophan metabolism
    101032494
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    101032494
   00760 Nicotinate and nicotinamide metabolism
    101032494
   00830 Retinol metabolism
    101032494
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101032494
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101032494
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     101032494
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2 DHODB_Fe-S_bind
Other DBs
NCBI-GeneID: 101032494
NCBI-ProteinID: XP_010334758
LinkDB
Position
Unknown
AA seq 1343 aa
MPYASRSDELVFFVNGRKVIERNVDPEGTLLTFLRKNLRLTGTKYACGRGGCGACTVMVS
KHDSVSKKIRHFSVAACLMPICSLYGAAVTTVEGVGSIKTRLHPVQERIAKSHGTQCGFC
TPGMVMSMYTLLRNHPQPSEEQLMEALGGNLCRCTGYRPICESGRTFCLEANSCQQKGKG
KCCLDWGEHDSSPLGKKNEICTKLFAKEEFQPLDPTQELIFPPELLRMAENPEKQTLTFC
GERVTWISPGTLKDLLELKAKHPEAPLILGNTSLGPGMKSQGHFHPVLLSPARISELSMV
TKTSDGLTIGAGCSLAQMQAILAERISELPEEKTQTYRALLKHLRILAGQQIRNMASLGG
HVMSRHCYSDLNPILAVGNSTLNLISAEGTRQIPLNEHFLAGLASADVEPEEILESVHIP
HSQKWEFVSAFRQAQCQQNALPHVNAGMRVLFKGGTDSIEDLHIAYGGVGTATISAHRFC
QQLLGRRWNELMLDEACKLLLDEVSLPGSARGGRVEFKRTLVVSFLFKFYLEVLQELKKL
VKLFSASGCSCDGRYSEISEGFLSALEDFPVAIPQGVQTYQSVDPHQPLQDPVGRPIMHL
SGLKHATGEAIFCDDIPMVDKELFMALVTSNRAHAKIISIDVSKALEIPGVVDVITAEDI
PGTNGTEGDKLLAVDEVICVGQIICAVVAETDVQAKRATEKIKITYEDLEPVIFTIKDAI
KHNSFLCPKKKLEQGNIEEAFEKVDQIIEEVHVGGQEHFYMETQRVLVIPKTEDKELDIY
VSTQDLAHVQVSVLCFKHPHQQDHLSCKTSGWRFWREDRKASCIRGDCGCGTGHPIRLVL
DREDDMLITGGRHPLFGKYKVGFMNNGRIKALDIECFINGGCTLDDSELVTEFLILKLEN
AYKIHHLRFQGRACMTNLPSNTAFRGFGFPQGALVTESCITAVAAKCGLPPEKIREKNMY
KTVDKTIYNQAFNPETLIRCWNECLDKSSFHSRRMQAEEFNKKNYWKKKGIAIIPMKFSV
GFAATSYHQAAALVHIYTDGSVLVTHGGSELGQGIHTKMLQVASRELKIPMSYIHICETG
TATVPNTIATAASIGADVNGRAVQNACQILLKRLEPIIKKHPEGTWEDWIEAAFEQRISL
SATGYFRGYKAFMDWEKGVGDPFPYYVYGAACSEVEIDCLTGAHKKIRTDIIMDACCSLN
PAIDIGQIEGSFIQGMGLYTTEELQYSPEGVLYSRSPDEYKIPIITDVPEEFNVSLLPSS
HTPLTIYSSKGLGESGMFLGSSVFFAIADAVATVRRERGIAEDFTVQSPATPEWVRMACA
DRFTDMIPRDDPKTFKPWSIPIA
NT seq 4032 nt   +upstreamnt  +downstreamnt
atgccttacgcatcacgatcagacgagctggttttcttcgtgaacgggaggaaggtgata
gagaggaatgtggacccggaagggaccctgctgaccttcctacggaagaacttacgtctc
acaggaaccaagtacgcctgcggaagaggaggctgtggcgcctgcaccgtgatggtgtcc
aagcatgactccgtgtccaagaagataagacacttctccgtcgccgcatgcctgatgccc
atctgctctctgtatggagctgctgtgaccaccgtggaaggtgttggaagcatcaaaact
cggcttcatcctgtgcaggagcggatcgccaagagccacggcacccagtgtggattctgc
acccctgggatggtgatgtccatgtacacgctgctcaggaaccacccacagccctcggag
gagcagctcatggaagccctggggggtaacctatgccgctgcactgggtatcggccaata
tgtgagagtgggaggaccttctgcctggaggcaaatagctgtcaacagaaaggaaaagga
aaatgctgtttggattggggagaacatgactcttccccacttggcaagaaaaatgagatt
tgcacgaagttatttgcaaaagaggagtttcagcccttggacccgacccaggagctcata
tttcccccagaactcttgaggatggcagagaatccagaaaaacaaacactgaccttctgt
ggagagagagttacctggatctcccctgggaccctcaaggatctcctggagctgaaagcg
aaacaccccgaagcccctctcattctgggtaacacctcactgggacctggaatgaaatct
caagggcattttcatccagttctcctctctcctgcaaggatctctgagctgagtatggtg
acaaaaacaagtgatggactgacaataggtgctggctgcagcctggcccagatgcaggcc
atcttggctgagaggatatctgagctcccagaggagaaaacacagacataccgagccctc
ctaaagcacctgaggattctggcaggccagcagatccggaatatggcatccttagggggg
catgtgatgagccggcattgctattcggacctgaatccaattcttgctgtgggcaattct
accctcaatctgatttcagcagaaggcacgcggcagattcctctaaatgaacattttctt
gctgggttggcaagtgcagacgttgagccagaggaaattttggaatctgtgcatatcccg
cactctcaaaagtgggaatttgtgtccgccttccgacaggctcagtgccagcagaatgcc
ttgccccacgtgaatgccggcatgcgagtccttttcaaaggaggcacagacagcattgag
gacctgcacattgcctatggaggagtggggactgccaccatcagtgcacacagattctgc
cagcagctcctcgggaggcgctggaatgagctgatgctggatgaggcttgcaagctgctg
ctggatgaagtctcgctcccaggctcagcccgaggtggccgggtggaattcaagaggacc
ctagtcgtcagcttcctcttcaaattctacctagaagttctgcaggaactgaagaagctg
gtgaagttattctctgcctccgggtgctcttgtgacggccgttattctgaaatttcagaa
ggattcttaagtgctctagaagatttcccagtcgcaataccccagggagtccaaacgtac
cagagtgtggatcctcaccagcctctccaagacccagttggacgccccatcatgcacctg
tcaggtcttaaacatgccactggggaagccattttttgtgatgacattcctatggtggat
aaagaacttttcatggctttggtgactagtaacagggctcacgcaaaaattatatcaatt
gatgtgtccaaggcccttgaaatacctggggttgttgatgtgataacagctgaagacatt
ccaggcaccaatggcactgaaggtgacaaattgctggctgtagatgaggtaatctgcgtg
ggccagatcatctgtgctgtggttgcagagacagatgtacaggcaaaacgagcaactgaa
aagataaagatcacctatgaagatctggaacctgtaatcttcaccatcaaggatgccata
aaacacaattcattcctgtgccctaaaaaaaaacttgaacaaggaaacattgaggaggca
tttgaaaaagtcgaccaaattattgaagaggtccatgttggaggacaggaacatttttac
atggaaacacaaagagtgcttgttattccaaagacagaggacaaagaactggacatttat
gtatccacacaggacctagcccacgtgcaggtgagtgtcctctgctttaaacatccccat
cagcaggatcacctgtcatgtaaaacgagtgggtggaggttttggagggaagacaggaaa
gccagctgtattcggggcgattgcggctgtggaactggtcatcctattcgtcttgtcctt
gatcgtgaagatgatatgttaataactggaggaaggcacccattatttggaaaatataaa
gtaggattcatgaacaacgggcggatcaaagctctagacatcgagtgcttcattaatgga
gggtgcacgctggatgactctgagctggtaacagaatttctaatactaaagctggaaaat
gcatataaaattcaccacctcaggttccagggccgtgcatgcatgacaaatttaccatcc
aatacggcctttcgtggatttggtttcccacaaggagccctagtaacagaatcttgcatc
acagctgtggcagccaaatgtggccttccaccagaaaagattagggagaaaaatatgtac
aaaacagttgataaaaccatctacaatcaagcattcaaccccgagaccctgataagatgc
tggaatgaatgtctggacaagtcttcctttcacagcagaagaatgcaagcagaagagttc
aataagaagaattattggaagaagaaaggcattgccattattcccatgaagttttcagtt
ggctttgctgcaacaagctatcatcaggcagctgcactggttcatatctatacagatggg
tctgtgttggtcacacatggaggcagtgagctgggacaaggtattcacaccaaaatgcta
caggtggctagccgggagttaaaaatacctatgtcgtatatacacatctgtgaaacgggc
acagcaacagtgcccaatacaattgctacagcggcatccattggggcagatgtcaatggc
agagctgtgcagaatgcttgtcagatccttctgaaacgccttgagcccatcattaagaaa
catccggaaggtacatgggaagactggatagaagctgcatttgaacaaagaatcagtctc
tcagccactggatacttcaggggctataaggccttcatggactgggagaaaggggtgggg
gacccatttccttactatgtctatggagctgcctgttctgaggttgaaattgactgcctg
acaggtgctcacaagaaaatcagaacggacatcatcatggatgcgtgttgcagcctcaat
ccggccattgatattgggcagattgaaggttcgtttattcaaggaatggggctttatacc
actgaagaactgcaatattccccagaaggtgtcctgtactctcggagcccagatgagtac
aaaattccaatcatcactgatgtcccggaggagttcaatgtctccttgttgccatcgtca
cacaccccactaaccatctattcatctaagggccttggggagtctgggatgttcctgggg
tcatctgtgttctttgccattgctgacgctgtggccacagtacgaagagaaagaggcata
gctgaggacttcacggtgcagagcccagcaacaccagaatgggtccgaatggcctgtgca
gatcgattcacagacatgatcccaagagacgaccctaagacatttaagccttggtctatc
cctatagcataa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033246
Entry
101033246         CDS       T04350                                 

Definition
(RefSeq) aldehyde oxidase
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00280  Valine, leucine and isoleucine degradation
sbq00350  Tyrosine metabolism
sbq00380  Tryptophan metabolism
sbq00750  Vitamin B6 metabolism
sbq00760  Nicotinate and nicotinamide metabolism
sbq00830  Retinol metabolism
sbq00982  Drug metabolism - cytochrome P450
sbq01100  Metabolic pathways
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101033246
   00350 Tyrosine metabolism
    101033246
   00380 Tryptophan metabolism
    101033246
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    101033246
   00760 Nicotinate and nicotinamide metabolism
    101033246
   00830 Retinol metabolism
    101033246
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101033246
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101033246
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     101033246
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2 ACP_syn_III_C
Other DBs
NCBI-GeneID: 101033246
NCBI-ProteinID: XP_003925726
UniProt: A0A2K6UKR4
LinkDB
Position
Unknown
AA seq 1338 aa
MDRTPELLFYVNGRKVTEKNVDPETMLLPYLRRKLRLTGTKYGCGGGGCGACTVMISRYN
PITKRIRHHPANACLIPICSLYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTFCKTSGCCQSKENGICC
LDQGINGLPEFEEGSETSPKLFTEEEFLPLDPTQELIFPPELMIMAEKQPQRTRMFGSER
MAWFSPVTLKELLELKFKYPQAPVVMGNTSVGPEVKFKGVFHPVVISPDRIEELSVVIHA
SNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYRALLKHLRTLAGSQIRNMASLGGHII
SRHPDSDLNPLLAVGNCTLNLLSKEGKRQIPLDEQFLSKCPNADLKPQEILISVNIPYSR
KWEFVSAFRQAQRQENALPIVNSGMRVFFGEEDGIIRELSISYGGIGPTTICAKDSCQKV
IGRHWNEEMLDTACRLVLNEVSLPGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKTNSV
HYPSLADKYASALEDLHSRHHCSTLKYQKIGPKQHPEDPVGHPIMHLSGVKHATGEAIYC
DDMPPVDQELFLTFVTSSRAHAKILSIDLSEALSMPGVVDIMTAEHLSDVNSFCFFTETE
TFLATDKVFCVGHLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEEAIQHNSFFKPE
RKLEYGNVDEAFKVVDHILEGEIHMGGQEHFYMETQSMLVVPKGEDQEIDVYVSTQFPKY
IQDIVASTLKLPANKVMCHVRRVGGAFGGKAFKTGTIAAVTAFAANKHGRAVRCVLERGE
DMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGTSLEESLFVIEMGLLKMDNAYKF
PNLRCQGWACRTNLPSNTAFRGFGFPQAGLITESCIVEVAAKCGLSPEKVRMINMYKEID
QTPYKQEINAKNLAQCWRECMAMSSYSERKVVVEKFNMENYWKKKGLSMVPLKFPVGLGS
RAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVASRELRMPMSNVHLRGTSTETV
PNANVSGGSVVADLNGLAVKNACQTLLKRLEPIISKNPKGTWKDWAQTAFNESISLSAVG
YFRGYESDMNWEKGEGHPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPALD
IGQIEGAFIQGMGLYTIEELNYSPQGVLHTRGPDQYKIPAICDMPTQLHISLLPPSQNSN
TLYSSKGLGESGVFLGCSVFFAIHDAVSAARRERGLRGPLRLNSPLTPEKIRMACEDKFT
KMIPRDEPGSYVPWNVPI
NT seq 4017 nt   +upstreamnt  +downstreamnt
atggaccggacgccggagctgctcttctacgttaacggccgcaaggtgacagaaaaaaat
gtcgatcctgaaacaatgctgttgccttatctgaggaggaagctccgactcacaggaacc
aagtatggctgtggaggaggaggctgtggtgcatgtacagtgatgatatcacgatataat
cccatcaccaagagaataaggcatcacccagccaatgcctgtctgattcccatctgttct
ctgtatggtgctgctgtcaccacagtagaaggcataggaagcacccacaccagaattcat
cctgttcaggagaggatcgccaagtgtcatggcacccagtgtggcttctgcacacctggg
atggtgatgtccatctacaccctgctcaggaaccacccagaacccactctggatcaatta
actgatgcccttggtggtaacctgtgccgttgcactggatacaggcccataattgatgca
tgcaagactttctgtaaaacttcaggttgctgtcaaagtaaagaaaatgggatttgctgt
ttggatcaaggaatcaatggattgccagaattcgaggaaggaagtgagacaagtccaaaa
ctcttcacagaagaggagtttctgccattggatccaacccaggaactgatatttcctcct
gagctaatgataatggctgagaaacagccccagaggaccaggatgtttggcagtgagaga
atggcatggttttcccccgtgaccctgaaggaactgctggaattgaaattcaagtatccc
caggcccctgttgttatgggaaacacctccgtggggcctgaagtgaaatttaaaggtgtc
tttcacccagttgtaatttctcctgatagaattgaagaactgagtgttgtaatccatgca
tctaatggactcacccttggtgctggtctcagcctagcccaagtgaaggacattttggct
gatgtggtccagaagcttccagaggagaagacacagatgtaccgagctctcttgaagcat
ttgagaactctggctgggtcccagatcagaaacatggcttctttagggggacacatcatt
agcaggcatccggattcagatctgaatcccctcctggctgtgggtaactgtaccctcaac
ttgctatcaaaagaaggaaaacgacagattcctttagatgagcagttcctcagcaagtgc
ccgaatgcagatcttaagcctcaagaaatcttgatctcagtgaacatcccctactcaagg
aagtgggaatttgtgtcagccttccgacaagcccagcggcaagagaatgcactaccgata
gtcaattcgggaatgagagtcttttttggagaagaggatggcattattagagaattatcc
atctcatatggaggcattggtccaaccaccatctgtgccaaggattcctgccagaaagtc
attggaaggcactggaatgaagaaatgctagatacagcttgcaggcttgttctgaatgaa
gtgtcgcttccgggctcggctccaggtgggaaggtggagttcaagaggaccctcatcatc
agcttcctcttcaagttctacctggaagtgtcacagattttgaaaaagacgaactcagtt
cactatcctagccttgcagacaagtatgcaagtgctttagaagatcttcattccagacat
cactgcagtacattaaagtaccagaaaataggcccaaagcagcatcctgaagacccagtt
ggccatcccatcatgcatctgtctggtgtgaagcatgccacgggggaggccatctactgt
gatgacatgcctccagtggaccaggaacttttcttgacttttgtgactagttcaagagct
catgctaagattttgtctattgatctgtcagaagctctcagcatgcccggtgtagtggac
atcatgacagcagaacatcttagtgacgtcaattccttctgctttttcactgaaactgag
acatttctggcaacagataaggtgttctgtgtgggtcaccttgtctgtgccgtgcttgcc
gattctgaggttcaggcaaagcgagctgctaagcgagtaaagattgtctatcaagacttg
gagccactgatcctaacaatcgaggaagctatacaacacaactccttcttcaagccagaa
aggaaactggaatatggaaatgttgatgaagcatttaaagtagttgatcacattcttgaa
ggtgaaatacatatgggaggtcaagaacatttttatatggaaacccaaagtatgcttgtg
gttcccaaaggagaggatcaagaaatagatgtctatgtgtccacacagtttcccaaatat
atacaggacatagttgcctcaaccttgaagctcccagctaacaaggtcatgtgtcatgta
aggcgtgttggtggagcgtttggagggaaagcgttcaagactggaaccattgcagctgtc
actgcgtttgctgcaaacaaacatggtcgtgcagttcgctgtgttctggaacgaggagaa
gacatgttaataactggaggccgccatccttaccttggaaagtacaaagctggattcatg
aatgatggcagaatcttggccctggacatggagcattatagcaatgcaggcacctccctg
gaagaatcattattcgtgatagaaatgggacttctgaaaatggacaatgcttacaagttt
cccaacctgcgctgccagggctgggcatgcagaaccaaccttccatccaacacggctttt
cgtgggtttggatttcctcaggcagggctgatcactgaatcttgtatcgtggaagttgca
gccaaatgtggactgtcccccgagaaggtgcgaatgataaacatgtacaaggaaattgat
caaacaccctacaaacaagagatcaatgccaagaacctggcccagtgttggagagaatgt
atggccatgtcttcctactctgagaggaaagtggttgtggaaaaattcaacatggagaat
tactggaagaagaaaggactgtccatggtccccttgaagtttcctgttggccttggctca
cgcgctgctggtcaggctgctgccttggttcacatttatcttgacggctcggtgctggtc
actcatggtggaattgaaatggggcagggggtccacactaaaatgattcaggtggccagc
cgtgaattaagaatgccaatgtcaaatgtccacctgcgtggaaccagcacagaaaccgtc
cctaatgcaaatgtctctggaggttctgtggtggcagacctcaatgggttggcagtaaag
aatgcctgtcaaactcttctaaaacgcctcgaacccatcatcagcaagaatcctaaagga
acttggaaagactgggcacagactgcttttaatgaaagcattagtctttcagctgttgga
tacttcaggggttacgagtcagatatgaactgggagaaaggtgaaggccatcccttcgaa
tactttgtttatggagctgcctgttccgaggtggaaatagactgcctgacgggggatcat
aagaacatcagaacagacattgtcatggatgttggctgcagtataaatccagcccttgac
atcggccagattgaaggtgcatttattcaaggcatgggactttatacaatagaggaactg
aattattctccccagggtgttctgcacactcgtggtccagaccaatataaaatccctgcc
atctgtgacatgcccacacagttgcacatttctttgttgcctccctctcaaaactcaaat
actctttattcatctaagggtctgggagagtcgggggtcttcctgggatgctccgtgttt
ttcgctatccatgatgcggtgagtgcagcgcgacgggaaagaggactacgcggacccttg
aggcttaatagtccactgaccccggagaagattaggatggcctgtgaagacaagttcaca
aaaatgattccaagagatgaacctggatcctatgttccttggaatgtacccatctaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042764
Entry
101042764         CDS       T04350                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: aldehyde oxidase 4-like
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00280  Valine, leucine and isoleucine degradation
sbq00350  Tyrosine metabolism
sbq00380  Tryptophan metabolism
sbq00750  Vitamin B6 metabolism
sbq00760  Nicotinate and nicotinamide metabolism
sbq00830  Retinol metabolism
sbq00982  Drug metabolism - cytochrome P450
sbq01100  Metabolic pathways
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101042764
   00350 Tyrosine metabolism
    101042764
   00380 Tryptophan metabolism
    101042764
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    101042764
   00760 Nicotinate and nicotinamide metabolism
    101042764
   00830 Retinol metabolism
    101042764
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101042764
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101042764
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     101042764
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C
Other DBs
NCBI-GeneID: 101042764
NCBI-ProteinID: XP_010334816
LinkDB
Position
Unknown
AA seq 694 aa
MFSGVTIGAGYSLTQLNDALHSIILEQLKEKTKTHQALLKHLRTLAGAQIRNMATLGGHM
VSRSNFSDLNPILAAGNATINLINLKVICMGQIVGTVAADTYAHAREAAKKVKKITYEDI
EPRIITTEESLEHNSFLVAEKKIEQGNVERAFKYVAQITEGKVHVEGQEHFYMETLSILA
LPKEEDKEMVLHLGTQYPNHMQEYVTTALNIPRSRIAFHMKRARGAFGGKVTKPALLEAV
SYVAANKTGHPIQFILECGDDILITAGCHLLHPGKYQIXFMNNGVMKAADIEYYINGGYT
PDESERMVEFIVLKPENAYHIPNFQCWGRACKTNLPSNTAFRGFGIPEGTAVVEAYITAV
ASQCNLPSEEVREINTYKRISKTAFKQTFNPKPLRRRWKECLEKPSFDARRLAAEEFNKK
DYWKKKGLAIVPVKYSIGIPIADKTQVAALVYIYLDGSVLVTHGSCELGQGLYTKMIQMA
SHELGILQSYIHLSETSTVTVPNAVLTAGSVGTDINGKAVQNVCQTLTAHLHPIIRKNSK
GKWEDWIAKAFEEHISLSVTGYSKGYQTNMDWXEEEGNAFPYYVYGEACSEVEVDYLLGA
HKLFRTDIIMDAAFSINPALNIGQTEGAFIQGTGFYTTEELKYSPEGVLYSRDDVQSHVK
VPVGPRRPNSSKPKVYDGTVSCHLTKTGEMKLNE
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgttttcaggggtaacaataggtgcaggatacagcctgacccagttgaatgatgcctta
cattcgatcattttggagcaactgaaggagaagactaagacccatcaagctcttctgaag
catctgaggacactcgcaggagcccagattaggaatatggccactttaggaggacatatg
gtgagccggtctaatttttctgacctcaaccccattttagcagcaggaaatgctaccatc
aatctgattaatctaaaggtaatttgcatgggccagatcgtcggcactgtggccgctgat
acctatgctcatgcaagggaggctgctaagaaagtgaagaagatcacttatgaagacata
gagccaaggattatcacaacagaggaatccctagagcacaattcatttcttgttgctgag
aaaaaaatcgagcaaggaaatgtagagcgagcctttaaatacgtcgcccaaatcactgaa
ggtaaggtccatgtggaaggacaggaacatttttacatggaaacattatctatcctggct
ctcccaaaagaagaagataaagaaatggtgttacaccttggaacacagtatccaaaccac
atgcaggaatatgtgactacagcactgaacatcccaaggagtagaatcgctttccacatg
aaaagagccagaggagcatttggagggaaagtgaccaagccagctctgctagaagctgtc
agttatgtggccgccaacaaaactggccatccaatccagtttatcctagagtgtggtgat
gacatactgataactgctggctgccacctactccatccaggaaaataccaaatttgattc
atgaacaatggtgtaatgaaagctgctgatatcgaatattacatcaatggcgggtacact
cctgatgagtctgagaggatggtagagttcattgtgctgaaacctgaaaatgcataccat
attcctaattttcagtgctggggtagggcttgcaaaacaaatttgccatccaacacagcc
tttcgaggatttggcattcctgagggtacggcggtagtcgaagcttacataactgctgtg
gcatctcaatgcaacttaccctctgaagaggttagagaaataaacacgtataagagaatt
agcaaaacagcctttaagcagacatttaatccaaagcccttgcgaagacgctggaaagaa
tgtctggagaaaccttcattcgatgctaggagactggctgcagaggaatttaacaaaaag
gattactggaagaagaaggggcttgccatagtccctgtgaaatattccatcgggatcccc
atagctgacaaaactcaggtggctgctctagtttacatctatctcgatggctctgtcttg
gtgactcatggtagctgtgaactgggacaaggcctgtacaccaaaatgattcagatggct
agtcacgaactcggcatcctccagtcatacatacacctgtccgaaacgagcactgtcaca
gtgcccaatgccgtcttaacagcaggatcagtggggacagacatcaatggaaaggctgtg
cagaatgtctgccaaactcttacagctcatcttcatcccatcatcaggaaaaactctaaa
ggaaaatgggaggattggattgcaaaagcctttgaagaacacatcagtctctcagttacc
ggatattccaaaggctaccagacaaatatggactggngagaggaggagggtaatgctttc
ccgtattatgtttatggagaagcctgttctgaggttgaagtcgattatctcctgggggct
cataagctttttagaaccgacatcatcatggatgctgctttcagcataaacccagccctg
aatattggacagactgagggagcatttattcaaggcacgggattctataccacagaagaa
ctgaaatactccccagaaggtgtgctttattctcgagacgatgttcagtcccatgttaaa
gtgcctgtggggccaagacgtcctaattcttctaagccaaaagtttatgatggaactgtt
tcgtgtcaccttacaaaaactggggaaatgaagctgaatgaatag

DBGET integrated database retrieval system