KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032521
Entry
101032521         CDS       T04350                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq03320  PPAR signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04210  Apoptosis
sbq04510  Focal adhesion
sbq04660  T cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq04910  Insulin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04931  Insulin resistance
sbq04960  Aldosterone-regulated sodium reabsorption
sbq05145  Toxoplasmosis
sbq05205  Proteoglycans in cancer
sbq05213  Endometrial cancer
sbq05215  Prostate cancer
sbq05223  Non-small cell lung cancer
sbq05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101032521 (PDPK1)
   04071 Sphingolipid signaling pathway
    101032521 (PDPK1)
   04151 PI3K-Akt signaling pathway
    101032521 (PDPK1)
   04152 AMPK signaling pathway
    101032521 (PDPK1)
   04150 mTOR signaling pathway
    101032521 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101032521 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    101032521 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101032521 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101032521 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    101032521 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101032521 (PDPK1)
   03320 PPAR signaling pathway
    101032521 (PDPK1)
   04919 Thyroid hormone signaling pathway
    101032521 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101032521 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101032521 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101032521 (PDPK1)
   05231 Choline metabolism in cancer
    101032521 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101032521 (PDPK1)
   05213 Endometrial cancer
    101032521 (PDPK1)
   05223 Non-small cell lung cancer
    101032521 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101032521 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101032521 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101032521 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101032521 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101032521 (PDPK1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101032521 (PDPK1)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   101032521 (PDPK1)
Membrane trafficking [BR:sbq04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    101032521 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 101032521
NCBI-ProteinID: XP_010337346
LinkDB
Position
Unknown
AA seq 529 aa
MVRTQTESSTAPGVPGGSRQGPAMDGTAAEPRPSAGSLQHTQPPPQPRKKRPEDFKFGKI
LGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYF
TFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLK
PENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWA
LGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGC
EEMEGYGPLKAHPFFESITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQ
VSSSSSSHSLSASEAGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNP
WHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPE
AKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggtgaggacccagactgagtccagcacggcccctggcgttcctggtggcagcaggcag
ggccccgccatggatggcaccgcagccgagcctcggcccagtgccggctccctgcaacac
acccagccgccgccgcagcctcggaagaagcggcctgaggacttcaagttcgggaaaatt
cttggggaaggctctttttccacagttgtcctggctcgagaactggcaacctccagagaa
tatgcgattaaaattctggagaagcgacatatcataaaagagaacaaggtcccatatgta
accagagagcgggatgtgatgtcgcgcctggatcaccccttctttgttaagctttacttc
acgtttcaggacgacgagaagctgtatttcggccttagttatgccaaaaatggagaacta
cttaaatatattcgcaaaattggttcattcgatgagacctgtacccgattttacacggct
gagattgtgtctgctttagagtacttgcacggcaagggcatcattcacagggaccttaaa
ccagaaaacattttattaaatgaagatatgcacatccagatcacagactttggaacagca
aaagtattatccccagagagcaaacaagccagggccaactcgttcgtgggaacagcgcag
tacgtttctccagagctgctcacggagaagtctgcctgtaagagttcagacctctgggct
cttggatgcataatataccagcttgtggcaggactcccaccattccgagctggaaatgag
tatcttatatttcagaagatcattaagttggaatatgactttccagaaaaattcttccct
aaggcaagagaccttgtggaaaaacttttggttctagatgccacaaagcggttaggctgt
gaggaaatggaagggtacggacctcttaaagcacaccccttcttcgagtccatcacgtgg
gagaacctgcaccagcagacgcctccaaagctcaccgcttacctgccagccatgtcggaa
gacgatgaggactgctatggcaattacgacaatctcctgagccagtttggctgcatgcag
gtgtcctcatcgtcctcctcacactccctgtcagcctcggaagcaggcctgccccagagg
tcaggtagcaacatagagcagtacatccacgacctggactcgaactcctttgaactggac
ttacagttttctgaagacgagaagaggttgttattggagaagcaagctggcggaaaccct
tggcaccaatttgtagaaaataatttaatactaaagatgggcccagtggataagcggaag
ggtttatttgcacgaagacgacagttgttgctcacagaagggccacatttatattatgtg
gatcctgtcaacaaagtcctgaaaggtgaaattccttggtcacaagaacttcgaccagaa
gccaagaattttaaaactttctttgtccacacgcctaacaggacgtattatctgatggac
cccagtgggaatgcacacaagtggtgcaggaagatccaggaggtttggaggcagcgatac
cagagccacccagatgccgcggttcagtga

DBGET integrated database retrieval system