KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032613
Entry
101032613         CDS       T04350                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04070  Phosphatidylinositol signaling system
sbq04071  Sphingolipid signaling pathway
sbq04150  mTOR signaling pathway
sbq04270  Vascular smooth muscle contraction
sbq04310  Wnt signaling pathway
sbq04370  VEGF signaling pathway
sbq04510  Focal adhesion
sbq04540  Gap junction
sbq04613  Neutrophil extracellular trap formation
sbq04650  Natural killer cell mediated cytotoxicity
sbq04666  Fc gamma R-mediated phagocytosis
sbq04670  Leukocyte transendothelial migration
sbq04713  Circadian entrainment
sbq04720  Long-term potentiation
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04727  GABAergic synapse
sbq04728  Dopaminergic synapse
sbq04730  Long-term depression
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04911  Insulin secretion
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04925  Aldosterone synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04929  GnRH secretion
sbq04935  Growth hormone synthesis, secretion and action
sbq04960  Aldosterone-regulated sodium reabsorption
sbq04961  Endocrine and other factor-regulated calcium reabsorption
sbq04970  Salivary secretion
sbq04971  Gastric acid secretion
sbq04972  Pancreatic secretion
sbq05017  Spinocerebellar ataxia
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05031  Amphetamine addiction
sbq05032  Morphine addiction
sbq05143  African trypanosomiasis
sbq05146  Amoebiasis
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05214  Glioma
sbq05223  Non-small cell lung cancer
sbq05225  Hepatocellular carcinoma
sbq05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101032613 (PRKCG)
   04012 ErbB signaling pathway
    101032613 (PRKCG)
   04014 Ras signaling pathway
    101032613 (PRKCG)
   04015 Rap1 signaling pathway
    101032613 (PRKCG)
   04310 Wnt signaling pathway
    101032613 (PRKCG)
   04370 VEGF signaling pathway
    101032613 (PRKCG)
   04066 HIF-1 signaling pathway
    101032613 (PRKCG)
   04020 Calcium signaling pathway
    101032613 (PRKCG)
   04070 Phosphatidylinositol signaling system
    101032613 (PRKCG)
   04071 Sphingolipid signaling pathway
    101032613 (PRKCG)
   04150 mTOR signaling pathway
    101032613 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101032613 (PRKCG)
   04540 Gap junction
    101032613 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101032613 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    101032613 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    101032613 (PRKCG)
   04670 Leukocyte transendothelial migration
    101032613 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    101032613 (PRKCG)
   04929 GnRH secretion
    101032613 (PRKCG)
   04921 Oxytocin signaling pathway
    101032613 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    101032613 (PRKCG)
   04918 Thyroid hormone synthesis
    101032613 (PRKCG)
   04919 Thyroid hormone signaling pathway
    101032613 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    101032613 (PRKCG)
   04916 Melanogenesis
    101032613 (PRKCG)
   04925 Aldosterone synthesis and secretion
    101032613 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101032613 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    101032613 (PRKCG)
   04971 Gastric acid secretion
    101032613 (PRKCG)
   04972 Pancreatic secretion
    101032613 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101032613 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101032613 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    101032613 (PRKCG)
   04727 GABAergic synapse
    101032613 (PRKCG)
   04725 Cholinergic synapse
    101032613 (PRKCG)
   04728 Dopaminergic synapse
    101032613 (PRKCG)
   04726 Serotonergic synapse
    101032613 (PRKCG)
   04720 Long-term potentiation
    101032613 (PRKCG)
   04730 Long-term depression
    101032613 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    101032613 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101032613 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101032613 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101032613 (PRKCG)
   05206 MicroRNAs in cancer
    101032613 (PRKCG)
   05205 Proteoglycans in cancer
    101032613 (PRKCG)
   05231 Choline metabolism in cancer
    101032613 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101032613 (PRKCG)
   05214 Glioma
    101032613 (PRKCG)
   05223 Non-small cell lung cancer
    101032613 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101032613 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    101032613 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    101032613 (PRKCG)
   05032 Morphine addiction
    101032613 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101032613 (PRKCG)
   05161 Hepatitis B
    101032613 (PRKCG)
   05171 Coronavirus disease - COVID-19
    101032613 (PRKCG)
   05163 Human cytomegalovirus infection
    101032613 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101032613 (PRKCG)
   05143 African trypanosomiasis
    101032613 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101032613 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101032613 (PRKCG)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101032613 (PRKCG)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101032613 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like APH
Other DBs
NCBI-GeneID: 101032613
NCBI-ProteinID: XP_010330272
UniProt: A0A2K6SQ77
LinkDB
Position
Unknown
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggctggtctgggccccggcggaggtgattcagaggggggaccccggcccctgttttgt
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggtatcgga
aagcagggcctgcaatgtcaagtctgcagctttgtggttcatcggcgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgacccccggaacaag
cacaagttccgcctgcacagctacagcagccccaccttctgcgaccactgtggctccctc
ctgtatgggcttgtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgtagcgtgccctccctgtgcggtgtggaccacaccgagcgccgcgggcgc
ctgcagctggagatccgggctcccactgcggatgagatccacattacggttggtgaggcc
cgtaaccttattcccatggaccccaatggtctctctgatccctatgtgaaactgaagctc
atcccagaccctcggaacctgacgaaacagaagacccgaacggtgaaagccacgctaaac
cctgtgtggaatgagacctttgtgttcaacctgaagccaggggatgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacctcccgcaacgacttcatgggtgccatgtcc
tttggtgtctcagagctgctcaaggcgccggtggacggctggtacaagttactgaaccag
gaggagggcgagtattacaatgtgccagtggccgatgctgacaactgcagcctcctccag
aagtttgaggcttgtaactaccccctggaattgtatgagcgggtgcggatggggccctct
tcctcccccatcccttccccttcccctagtcccaccgaccccaagcgctgcttcttcggg
gcgagcccaggacgcctgcacatctccgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggccgagcgcaggggctccgatgagctctacgccatcaag
atcctgaaaaaggatgtcatcgtccaggacgacgatgtggactgcacgctggtggagaaa
cgcgtgctggcgctggggggccggggtcctggcggccggcctcacttcctcacccagctc
cactccaccttccagaccccagaccgcctatatttcgtgatggagtatgtcaccggggga
gacttgatgtaccacattcaacagctgggcaagtttaaggagccccatgcagcgttctac
gcagcagaaatcgccatcggcctcttcttccttcacaatcagggcatcatctacagggac
ctgaagctggacaatgtgatgctagatgctgagggacacatcaagatcactgacttcggc
atgtgtaaggagaacgtcttccccggcacaacaacccgcaccttctgcggaaccccggac
tacatagccccggagatcattgcctaccagccctatgggaagtctgtcgattggtggtcc
tttggagttctgctgtatgagatgttggcaggacagcctcccttcgatggggaggacgaa
gaggagctgtttcaggccatcatggaacaaactgtcacctaccccaagtcgctttcccgg
gaagccgtggccatctgcaaggggttcctgaccaagcacccagggaagcgcctgggctca
gggcctgatggggaacccaccatccgtgcacacggctttttccgctggattgactgggag
cggctggaacgattggagatcccgcctcctttcagaccccgcccgtgtggccgcagtggc
gagaactttgacaagttcttcacgcgggcggcgccagcgctgacccctccagaccgccta
gtcctggccagcatcgaccaggccgatttccagggcttcacctacgtgaaccccgacttc
gtgcacccggatgcccgcagccccaccagcccagtgcctgtgcctgtcatgtaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039384
Entry
101039384         CDS       T04350                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04062  Chemokine signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04070  Phosphatidylinositol signaling system
sbq04071  Sphingolipid signaling pathway
sbq04150  mTOR signaling pathway
sbq04270  Vascular smooth muscle contraction
sbq04310  Wnt signaling pathway
sbq04370  VEGF signaling pathway
sbq04510  Focal adhesion
sbq04540  Gap junction
sbq04613  Neutrophil extracellular trap formation
sbq04650  Natural killer cell mediated cytotoxicity
sbq04662  B cell receptor signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04670  Leukocyte transendothelial migration
sbq04713  Circadian entrainment
sbq04720  Long-term potentiation
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04727  GABAergic synapse
sbq04728  Dopaminergic synapse
sbq04730  Long-term depression
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04911  Insulin secretion
sbq04912  GnRH signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04925  Aldosterone synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04929  GnRH secretion
sbq04931  Insulin resistance
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq04960  Aldosterone-regulated sodium reabsorption
sbq04961  Endocrine and other factor-regulated calcium reabsorption
sbq04970  Salivary secretion
sbq04971  Gastric acid secretion
sbq04972  Pancreatic secretion
sbq04973  Carbohydrate digestion and absorption
sbq05017  Spinocerebellar ataxia
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05031  Amphetamine addiction
sbq05032  Morphine addiction
sbq05140  Leishmaniasis
sbq05143  African trypanosomiasis
sbq05146  Amoebiasis
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05214  Glioma
sbq05223  Non-small cell lung cancer
sbq05225  Hepatocellular carcinoma
sbq05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101039384 (PRKCB)
   04012 ErbB signaling pathway
    101039384 (PRKCB)
   04014 Ras signaling pathway
    101039384 (PRKCB)
   04015 Rap1 signaling pathway
    101039384 (PRKCB)
   04310 Wnt signaling pathway
    101039384 (PRKCB)
   04370 VEGF signaling pathway
    101039384 (PRKCB)
   04064 NF-kappa B signaling pathway
    101039384 (PRKCB)
   04066 HIF-1 signaling pathway
    101039384 (PRKCB)
   04020 Calcium signaling pathway
    101039384 (PRKCB)
   04070 Phosphatidylinositol signaling system
    101039384 (PRKCB)
   04071 Sphingolipid signaling pathway
    101039384 (PRKCB)
   04150 mTOR signaling pathway
    101039384 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101039384 (PRKCB)
   04540 Gap junction
    101039384 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101039384 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    101039384 (PRKCB)
   04662 B cell receptor signaling pathway
    101039384 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    101039384 (PRKCB)
   04670 Leukocyte transendothelial migration
    101039384 (PRKCB)
   04062 Chemokine signaling pathway
    101039384 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    101039384 (PRKCB)
   04929 GnRH secretion
    101039384 (PRKCB)
   04912 GnRH signaling pathway
    101039384 (PRKCB)
   04921 Oxytocin signaling pathway
    101039384 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    101039384 (PRKCB)
   04918 Thyroid hormone synthesis
    101039384 (PRKCB)
   04919 Thyroid hormone signaling pathway
    101039384 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    101039384 (PRKCB)
   04916 Melanogenesis
    101039384 (PRKCB)
   04925 Aldosterone synthesis and secretion
    101039384 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101039384 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    101039384 (PRKCB)
   04971 Gastric acid secretion
    101039384 (PRKCB)
   04972 Pancreatic secretion
    101039384 (PRKCB)
   04973 Carbohydrate digestion and absorption
    101039384 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101039384 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101039384 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    101039384 (PRKCB)
   04727 GABAergic synapse
    101039384 (PRKCB)
   04725 Cholinergic synapse
    101039384 (PRKCB)
   04728 Dopaminergic synapse
    101039384 (PRKCB)
   04726 Serotonergic synapse
    101039384 (PRKCB)
   04720 Long-term potentiation
    101039384 (PRKCB)
   04730 Long-term depression
    101039384 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    101039384 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101039384 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101039384 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101039384 (PRKCB)
   05206 MicroRNAs in cancer
    101039384 (PRKCB)
   05205 Proteoglycans in cancer
    101039384 (PRKCB)
   05231 Choline metabolism in cancer
    101039384 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101039384 (PRKCB)
   05214 Glioma
    101039384 (PRKCB)
   05223 Non-small cell lung cancer
    101039384 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101039384 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    101039384 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    101039384 (PRKCB)
   05032 Morphine addiction
    101039384 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101039384 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101039384 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101039384 (PRKCB)
   05161 Hepatitis B
    101039384 (PRKCB)
   05171 Coronavirus disease - COVID-19
    101039384 (PRKCB)
   05164 Influenza A
    101039384 (PRKCB)
   05163 Human cytomegalovirus infection
    101039384 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101039384 (PRKCB)
   05140 Leishmaniasis
    101039384 (PRKCB)
   05143 African trypanosomiasis
    101039384 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101039384 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101039384 (PRKCB)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101039384 (PRKCB)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101039384 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 101039384
NCBI-ProteinID: XP_003930252
UniProt: A0A2K6TWG3
LinkDB
Position
Unknown
AA seq 673 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagtgagggtgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaatgtgcacgaggtcaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcagggattccagtgccaagtttgctgctttgtggtgcacaagaggtgccatgaa
tttgtcacattctcctgccccggtgctgacaagggtccggcctctgatgatccccggagc
aaacacaagtttaagatccacacgtactccagccccacgttttgtgaccattgtgggtcg
ctgctgtatggactcatccaccaggggatgaaatgtgacacctgtatgatgaacgtgcac
aagcgctgcgtgatgaacgtccccagcctgtgcggcacggaccacacggagcgccgcggc
cgcatctacatccaggcccacatcgacagagacgtcctcattgtcctcgtaagagatgct
aaaaaccttgtacctatggaccccaatggcttgtcagatccctacgtaaaactgaaactg
attcctgatcctaaaagtgagagcaaacagaagaccaaaaccatcaaatgctccctcaac
cccgagtggaatgagacatttagatttcagctgaaagaatcagacaaagacagaagactg
tcagtagagatttgggattgggatttgaccagcaggaatgacttcatgggatctttgtcc
tttgggatttctgaactgcagaaagccagtgttgatggctggtttaagttactgagccag
gaagaaggcgagtacttcaacgtgcctgtcccaccagaaggaagtgagggcaatgaagag
ctgcggcagaaatttgagagggccaagatcagtcagggaaccaaggtcccagaagaaaag
acgaccaacactgtctccaaatttgacaacaatggcaacagagaccggatgaaactgacc
gattttaacttcctaatggtgctggggaaaggcagctttggcaaggtcatgctctcagag
cgaaaaggcacagatgagctctatgctgtgaagatcctgaagaaggacgtcgtaatccaa
gatgatgacgtggagtgcaccatggtggagaagcgggtgctggccctgcccgggaagcca
cccttcctgacccagctccactcctgcttccagactatggaccgcctgtactttgtgatg
gagtacgtgaatgggggtgacctcatgtatcacatccagcaagtcggccggttcaaggag
ccccatgctgtattttacgctgcagaaattgctatcggtctgttcttcttacagagtaag
ggcatcatttaccgtgacctaaaacttgacaacgtgatgctggattctgaggggcacatc
aagattgctgattttggcatgtgtaaggaaaacatctgggatggggtgacaaccaagaca
ttctgcggcactccagactacatcgcccccgagataattgcttatcagccctatgggaag
tccgtggattggtgggcatttggagtcctgctgtatgaaatgttggctgggcaggcaccc
tttgaaggggaagatgaagatgagctcttccagtccatcatggaacacaatgtagcctat
cccaagtctatgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacacccg
ggcaaacgtctgggttgcggacctgaaggcgaacgtgatatcaaagagcatgcatttttc
cggtatatcgattgggagaaacttgaacgcaaagagatccagcccccatataagccaaaa
gcttgtgggcgaaatgctgaaaacttcgaccgatttttcacccgccatccaccagtccta
acacctcccgaccaggaagtcatcaggaatattgaccaatcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacccgaagtcaagagctaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046010
Entry
101046010         CDS       T04350                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04070  Phosphatidylinositol signaling system
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04270  Vascular smooth muscle contraction
sbq04310  Wnt signaling pathway
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04510  Focal adhesion
sbq04540  Gap junction
sbq04613  Neutrophil extracellular trap formation
sbq04650  Natural killer cell mediated cytotoxicity
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04670  Leukocyte transendothelial migration
sbq04713  Circadian entrainment
sbq04720  Long-term potentiation
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04727  GABAergic synapse
sbq04728  Dopaminergic synapse
sbq04730  Long-term depression
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04911  Insulin secretion
sbq04912  GnRH signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04929  GnRH secretion
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq04960  Aldosterone-regulated sodium reabsorption
sbq04961  Endocrine and other factor-regulated calcium reabsorption
sbq04970  Salivary secretion
sbq04971  Gastric acid secretion
sbq04972  Pancreatic secretion
sbq05017  Spinocerebellar ataxia
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05031  Amphetamine addiction
sbq05032  Morphine addiction
sbq05143  African trypanosomiasis
sbq05146  Amoebiasis
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05214  Glioma
sbq05223  Non-small cell lung cancer
sbq05225  Hepatocellular carcinoma
sbq05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101046010 (PRKCA)
   04012 ErbB signaling pathway
    101046010 (PRKCA)
   04014 Ras signaling pathway
    101046010 (PRKCA)
   04015 Rap1 signaling pathway
    101046010 (PRKCA)
   04310 Wnt signaling pathway
    101046010 (PRKCA)
   04370 VEGF signaling pathway
    101046010 (PRKCA)
   04066 HIF-1 signaling pathway
    101046010 (PRKCA)
   04020 Calcium signaling pathway
    101046010 (PRKCA)
   04070 Phosphatidylinositol signaling system
    101046010 (PRKCA)
   04072 Phospholipase D signaling pathway
    101046010 (PRKCA)
   04071 Sphingolipid signaling pathway
    101046010 (PRKCA)
   04151 PI3K-Akt signaling pathway
    101046010 (PRKCA)
   04150 mTOR signaling pathway
    101046010 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101046010 (PRKCA)
   04540 Gap junction
    101046010 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101046010 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    101046010 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    101046010 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    101046010 (PRKCA)
   04670 Leukocyte transendothelial migration
    101046010 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    101046010 (PRKCA)
   04929 GnRH secretion
    101046010 (PRKCA)
   04912 GnRH signaling pathway
    101046010 (PRKCA)
   04921 Oxytocin signaling pathway
    101046010 (PRKCA)
   04926 Relaxin signaling pathway
    101046010 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    101046010 (PRKCA)
   04918 Thyroid hormone synthesis
    101046010 (PRKCA)
   04919 Thyroid hormone signaling pathway
    101046010 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    101046010 (PRKCA)
   04916 Melanogenesis
    101046010 (PRKCA)
   04925 Aldosterone synthesis and secretion
    101046010 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101046010 (PRKCA)
   04270 Vascular smooth muscle contraction
    101046010 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    101046010 (PRKCA)
   04971 Gastric acid secretion
    101046010 (PRKCA)
   04972 Pancreatic secretion
    101046010 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101046010 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101046010 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    101046010 (PRKCA)
   04727 GABAergic synapse
    101046010 (PRKCA)
   04725 Cholinergic synapse
    101046010 (PRKCA)
   04728 Dopaminergic synapse
    101046010 (PRKCA)
   04726 Serotonergic synapse
    101046010 (PRKCA)
   04720 Long-term potentiation
    101046010 (PRKCA)
   04730 Long-term depression
    101046010 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    101046010 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101046010 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    101046010 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101046010 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101046010 (PRKCA)
   05206 MicroRNAs in cancer
    101046010 (PRKCA)
   05205 Proteoglycans in cancer
    101046010 (PRKCA)
   05231 Choline metabolism in cancer
    101046010 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101046010 (PRKCA)
   05214 Glioma
    101046010 (PRKCA)
   05223 Non-small cell lung cancer
    101046010 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101046010 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    101046010 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    101046010 (PRKCA)
   05032 Morphine addiction
    101046010 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101046010 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101046010 (PRKCA)
   05161 Hepatitis B
    101046010 (PRKCA)
   05171 Coronavirus disease - COVID-19
    101046010 (PRKCA)
   05164 Influenza A
    101046010 (PRKCA)
   05163 Human cytomegalovirus infection
    101046010 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101046010 (PRKCA)
   05143 African trypanosomiasis
    101046010 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101046010 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101046010 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101046010 (PRKCA)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101046010 (PRKCA)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101046010 (PRKCA)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    101046010 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 C1_1 Pkinase_C APH Kinase-like
Other DBs
NCBI-GeneID: 101046010
NCBI-ProteinID: XP_010340801
LinkDB
Position
Unknown
AA seq 559 aa
MKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPN
GLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDR
TTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVELRQKFEKAK
LGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKI
LKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHI
QQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHM
MDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQS
IMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENRE
IQPPFKPKVTVCTKMHWLQWASRSSCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDF
EGFSYVNPQFVHPILQSAV
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgaaatgtgacacctgcgacatgaacgttcacaagcagtgtgtcatcaatgtccccagc
ctctgcggaatggatcacacagagaagagggggcggatttacctaaaggctgaggttgcg
gatgaaaagctccacgtcacagtacgagatgcaaaaaatctaatccctatggatccaaac
gggctttcagatccttacgtgaagctgaaacttattcctgatcccaagaacgaaagcaaa
caaaaaaccaaaaccatccgctccacactaaatccccagtggaacgagtcctttacattc
aaattgaaaccttcagacaaagaccggcgactgtctgtagaaatctgggactgggatcga
acaacaaggaatgacttcatgggatccctttcctttggagtatcggagctaatgaagatg
ccagccagtggctggtacaagttgcttaaccaagaagaaggtgagtactacaacgtaccc
attccggaaggggacgaagaaggaaatgtggagctgaggcagaaattcgagaaagccaag
cttggccctgctggcaacaaagtcatcagtccctctgaagacaggaaacaaccttccaac
aaccttgaccgagtgaaactcaccgacttcaatttcctcatggtgctggggaaagggagt
tttggaaaggtgatgcttgctgacaggaagggaacagaagaactgtacgcgatcaaaatc
ctgaagaaggacgtggtgattcaggatgatgacgtggagtgcaccatggtggaaaagcgg
gtcttggccctgttagacaaacccccgttcttgacgcagctgcactcctgcttccagaca
gtggaccggctgtacttcgtcatggaatacgtcaacggcggggacctcatgtaccacatt
cagcaagtaggaaaatttaaggaaccacaagcagtattctatgcggcagagatttccatt
ggattgttcttccttcataaaagaggaatcatttatagggatctgaagttagataacgtc
atgttggattcagaaggacatatcaaaattgctgactttgggatgtgcaaggaacacatg
atggatggagtcacgaccaggaccttctgtgggaccccagattatatcgccccggagata
atcgcttatcagccatatggaaaatctgtggactggtgggcctatggtgtcctgttgtat
gaaatgcttgccgggcagcctccatttgatggtgaagatgaagacgaactgtttcagtct
atcatggagcacaacgtgtcctatcccaaatccttgtccaaggaagctgtttccatctgc
aaaggactgatgaccaaacacccagccaagcggctgggctgcgggcccgagggcgagagg
gatgtgagagaacatgccttcttccggaggatcgactgggagaaactagagaacagggag
attcagccaccgttcaagcccaaagtgactgtgtgtaccaaaatgcactggcttcagtgg
gcctccaggtcttcgtgcggcaaaggagcagaaaactttgacaagttcttcacacgagga
cagcctgtcttaacaccgcccgatcagctggttattgctaacatagaccagtctgatttt
gaagggttctcgtatgtcaacccccagtttgtgcaccccatcttacagagtgcagtatga

DBGET integrated database retrieval system