KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032691
Entry
101032691         CDS       T04350                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A isoform X1
  KO
K05448  vascular endothelial growth factor A
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04020  Calcium signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04370  VEGF signaling pathway
sbq04510  Focal adhesion
sbq04926  Relaxin signaling pathway
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05219  Bladder cancer
sbq05323  Rheumatoid arthritis
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101032691 (VEGFA)
   04014 Ras signaling pathway
    101032691 (VEGFA)
   04015 Rap1 signaling pathway
    101032691 (VEGFA)
   04370 VEGF signaling pathway
    101032691 (VEGFA)
   04066 HIF-1 signaling pathway
    101032691 (VEGFA)
   04020 Calcium signaling pathway
    101032691 (VEGFA)
   04151 PI3K-Akt signaling pathway
    101032691 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101032691 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101032691 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101032691 (VEGFA)
   05206 MicroRNAs in cancer
    101032691 (VEGFA)
   05205 Proteoglycans in cancer
    101032691 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101032691 (VEGFA)
   05211 Renal cell carcinoma
    101032691 (VEGFA)
   05219 Bladder cancer
    101032691 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101032691 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101032691 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101032691 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101032691 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101032691 (VEGFA)
   05165 Human papillomavirus infection
    101032691 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101032691 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101032691 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101032691 (VEGFA)
Cytokines and growth factors [BR:sbq04052]
 Growth factors
  Growth factors (RTK binding)
   101032691 (VEGFA)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101032691 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF CXCXC
Other DBs
NCBI-GeneID: 101032691
NCBI-ProteinID: XP_010332232
LinkDB
Position
Unknown
AA seq 181 aa
MAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCN
DEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVPGKG
KGQKRKRKKPRPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPR
R
NT seq 546 nt   +upstreamnt  +downstreamnt
atggcagaaggaggagggcagaatcaccacgaagtggtgaagttcatggatgtctaccaa
cgcagctactgccatccaatcgagaccctggtggacatcttccaggagtaccctgatgag
atcgagtacatcttcaagccatcctgtgtgcccctgatgcgatgcgggggctgttgcaat
gacgagggcctggagtgtgtacccactgaggagttcaacatcaccatgcagattatgcgg
atcaaacctcaccaaggccagcacataggagagatgagcttcctacagcacaacaaatgt
gaatgcagaccaaagaaagatagagcaagacaagaaaaaaaatcagttccaggaaaggga
aaggggcaaaaacgcaagcgcaagaaaccccgtccctgtgggccttgctcagagcggaga
aagcatttgtttgtacaagatccacagacgtgtaaatgttcctgcaaaaacacagactcg
cgttgcaaggcgaggcagcttgagttaaacgaacgtacttgcagatgtgacaagccgagg
cggtga

DBGET integrated database retrieval system