KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032882
Entry
101032882         CDS       T04350                                 

Gene name
PLTP
Definition
(RefSeq) phospholipid transfer protein
  KO
K08761  phospholipid transfer protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101032882 (PLTP)
  09154 Digestive system
   04979 Cholesterol metabolism
    101032882 (PLTP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbq02000]
    101032882 (PLTP)
Transporters [BR:sbq02000]
 Other transporters
  Pores ion channels [TC:1]
   101032882 (PLTP)
SSDB
Motif
Pfam: LBP_BPI_CETP_C LBP_BPI_CETP
Other DBs
NCBI-GeneID: 101032882
NCBI-ProteinID: XP_003936508
UniProt: A0A2K6TZD6
LinkDB
Position
Unknown
AA seq 493 aa
MALYGALFLALLVGAHAELPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGH
FYYNISEVKVTELQLTSSELDFQPQQELMLQITNASLGLQFRRQLLYWFFYDGGYINASA
EGVSIRTGLELSRDSAGRMKVSNVSCQASVSRMHAAFGGTFKKVYEFLSTFITSGMRFLL
NQQICPVLYHAGTVLLNSLLDTIPVRSSVDDLVGIDYSLMKDPVASTSNLDMDFRGAFFP
LTEKNWSLPNRAVEPQLQEEERMVYVSFSEFFFDSAMESYFRAGALQLSLVGDKVPHDLD
MLLRASYFGSIVLMSPAVIDSPLKLELRVLAPPRCTIKPAGTTISVTASVTIALVPPDQP
EVQLSSMTMDARLSAKMALRGKALRTQLDLRRFRIYSNQSALESLALIPLQAPLKTLLQI
GVMPMLNERTWRGVQIPLPEGINFVREVVTNHAGFLTIGADLHFAKGLREVIEKNRSVDV
KASTAPPPSTAAV
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggccctctacggggccctcttcctggcgctgctggtaggcgctcacgcagagctccca
ggctgcaagatccgcgtcacctccaaggcgctagagctggtgaagcaggaggggctgcgt
tttctggagcaagaactggagaccatcaccattccggacctgcggggcaaagagggccac
ttctactacaacatctctgaggtgaaggtcacagagctgcagctgacatcttccgagctc
gatttccagccacagcaggaactgatgctacagatcaccaatgcctccttggggctgcag
ttccggcgacagctgctctactggttcttctatgatgggggctacatcaacgcctcagct
gagggcgtgtccatccgaactggtctggagctctcccgggattccgctggccggatgaaa
gtgtccaatgtctcctgccaggcttctgtctccagaatgcatgcggccttcggtggaacc
ttcaagaaggtgtatgagtttctctccacgttcatcacctcagggatgcgcttcctcctc
aaccagcagatctgccccgtactctaccatgcagggacggtcctgctcaactccctcctg
gacaccattcctgtgcgcagttctgtggatgacctcgttggcattgactactccctcatg
aaggatcctgtggcttccaccagcaacctggacatggacttccggggggccttcttcccc
ctgacagaaaagaactggagcctcccgaaccgggcggtggagccccagctgcaggaggag
gagcggatggtgtatgtgtccttctctgagttcttcttcgactctgccatggagagctac
ttccgggcaggggccctgcagctgtcgctggtgggggacaaggtgccccatgacctggac
atgctgctgagggccagctactttgggagcattgtcctgatgagcccagcagtgattgac
tccccgctgaagttggagttgcgtgttttggccccaccacgctgcaccatcaagcctgct
ggcaccaccatctctgtcactgccagcgtcaccattgccctggtccctccagaccagcct
gaggtccagctgtccagcatgactatggatgcccgtctcagcgccaagatggctctccgg
gggaaggccctgcgcacgcagctggacctgcgcaggtttcgaatctattccaaccagtct
gctctggagtcgctggctctgatcccactacaggcccctctgaagaccttgctgcagatt
ggggtgatgcccatgctcaatgagcggacctggcgtggggtgcagatcccactacctgag
ggcatcaactttgtgcgtgaggtggtgacaaaccatgcgggcttcctcaccattggggct
gatctccactttgccaaagggctgcgagaggtgattgagaagaaccggtctgttgatgtc
aaggcatccactgcccccccaccctccacagcagctgtctga

DBGET integrated database retrieval system