KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032922
Entry
101032922         CDS       T04350                                 

Gene name
SLC27A1
Definition
(RefSeq) long-chain fatty acid transport protein 1 isoform X1
  KO
K08745  solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04931  Insulin resistance
sbq04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101032922 (SLC27A1)
  09154 Digestive system
   04975 Fat digestion and absorption
    101032922 (SLC27A1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101032922 (SLC27A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbq01004]
    101032922 (SLC27A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbq02000]
    101032922 (SLC27A1)
Enzymes [BR:sbq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     101032922 (SLC27A1)
Lipid biosynthesis proteins [BR:sbq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101032922 (SLC27A1)
Transporters [BR:sbq02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   101032922 (SLC27A1)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C POTRA_2
Other DBs
NCBI-GeneID: 101032922
NCBI-ProteinID: XP_003942318
UniProt: A0A2K6UA63
LinkDB
Position
Unknown
AA seq 646 aa
MRAPGAGTASVVSLALLWLLGLPWTWSAAAALGVYVGSGGWRFLRIVCKTARRDLFGLSV
LIRVRLELRRHQRAGHTVPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLF
LQLGFVPGDVVAVFLEGRPEFVGLWLGLAKAGVEAALLNVNLRREPLAFCLGTSGAKALI
FGGEMAAAVAEVSGHLGKSLIKFCSGNVGPEGVLPDTHLLDLMLKEASTAPLAQIPSKGM
DDRLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGHHAYCMQAADVLYDCLPLYHSAGNIIG
VGQCLIYGLTVVLRKKFSASSFWDDCVKYNCTVVQYIGEICRYLLKQPVREAERRHRVRL
AVGNGLRPAIWEEFTQRFGVRQIGEFYGATECNCSIANMDGKVGSCGFNSRILPHVYPIR
LVKVNEDTMELLRDTRGLCIPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKIAHSV
FSKGDSVYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVY
GVAVPGVEGKAGMAAIADPQSLLDPNAMYQELQKVLAPYARPMFLRLLPQVDTTGTFKIQ
KTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGTFSL
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgcgggctccgggtgcgggcactgcctcggtggtctcgctggcgctcttgtggctgctg
ggcttgccgtggacctggagcgcggcagcggcgctcggcgtgtacgtgggcagcggcggc
tggcgcttcctgcgcatcgtctgcaagacggctaggcgagacctcttcggtctctctgtg
ctgatccgcgtgcgcctggagctgcggcggcaccagcgcgccggccacacggtcccgcgc
atctttcaggcggtggtgcagcggcagcccgagcgcctggcactggtggacgccgggacc
ggcgagtgctggactttcgcgcagctggacgcctactccaatgcggtggccaacctcttc
ctccagctgggctttgtgccgggtgacgtggtggccgttttcctggagggccggcccgag
ttcgtggggctgtggctgggcctggccaaggcgggcgtggaggccgcactgctcaacgtg
aacctgcggcgcgaacccctggccttctgtctgggcacctcgggcgccaaggccctcatc
tttggtggagaaatggcagcggcggtggccgaagtgagcgggcatctggggaaaagtttg
atcaagttctgctccggaaacgtggggcctgagggcgtcttgccggacacccacctcctg
gacctgatgctgaaggaggcctccactgcccctttggcacagatccccagcaagggcatg
gacgatcgtcttttctacatctacacgtcggggaccacggggctgcccaaggctgccatc
gtcgtgcacagcaggtactaccgcatcgcagccttcggccaccacgcctactgcatgcag
gcggctgacgtgctctatgactgcctgcccctgtaccactccgcagggaacatcataggt
gtgggacagtgtctcatctatgggctgacagtcgtcctccgcaagaaattctcggccagc
agcttctgggacgactgcgtcaagtacaactgcacggtggttcagtacattggggagatc
tgccgctacctgctgaagcagccggtgcgcgaggcggagaggcgacaccgcgtgcgcctg
gcggtggggaacggtctgcgtcccgccatctgggaggagttcactcagcgcttcggcgtg
cgccagatcggggagttctacggcgccacggagtgcaactgcagcattgccaacatggat
ggcaaggtcggctcctgtggtttcaacagccgcatcctgccccacgtgtaccccatccgg
ttggtgaaggtcaatgaggacacgatggagctgttgcgggatacccggggcctctgcatc
ccctgccaggccggggagcccggcctcctcgtgggtcagatcaaccagcaggacccgctg
cgccgcttcgacggctatgtcagcgagagcgcgaccagcaagaagatcgcccacagcgtc
ttcagcaagggcgacagcgtctatctctcaggtgacgtgctggtgatggatgagctgggc
tacatgtacttccgggaccgcagcggggataccttccgctggcgaggggagaacgtctcc
accaccgaggtggagggtgtcctgagccgcctgctgggccagacagacgtggccgtctat
ggggtggctgttccaggagtggagggtaaggcagggatggcggccatcgcggatccccag
agcctgctggaccccaatgcgatgtaccaggagctgcagaaggtgctggcgccctatgcc
cggcccatgttcctgcgcctcctgccccaggtggacaccacaggcaccttcaagatccag
aagacgaggctgcagcgagagggctttgacccacgccagacctcggaccggctcttcttc
ctggacctgaagcagggccactacctgcccttgaacgaggcggtctacactcgcatctgc
tcgggcactttctccctctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033269
Entry
101033269         CDS       T04350                                 

Gene name
SLC27A5
Definition
(RefSeq) bile acyl-CoA synthetase isoform X1
  KO
K08748  solute carrier family 27 (fatty acid transporter), member 5 [EC:6.2.1.7]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00120  Primary bile acid biosynthesis
sbq01100  Metabolic pathways
sbq03320  PPAR signaling pathway
sbq04931  Insulin resistance
sbq04976  Bile secretion
Module
sbq_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
sbq_M00106  Conjugated bile acid biosynthesis, cholate => taurocholate/glycocholate
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    101033269 (SLC27A5)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101033269 (SLC27A5)
  09154 Digestive system
   04976 Bile secretion
    101033269 (SLC27A5)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101033269 (SLC27A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbq02000]
    101033269 (SLC27A5)
Enzymes [BR:sbq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.7  cholate---CoA ligase
     101033269 (SLC27A5)
Transporters [BR:sbq02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   101033269 (SLC27A5)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 101033269
NCBI-ProteinID: XP_003944484
UniProt: A0A2K6TAN5
LinkDB
Position
Unknown
AA seq 689 aa
MGVRRRLALLLLLLLLWGLGQPVWPVAMALALRWLLGDPTCCVLLGLAMLARPWFSPWVS
HGLSLAAAALALTLLPARLPPGLRWLPADVAFLAKILQLGLNVRACLGRQPPYTFVDALE
RRARAQPGKAVLVWTGPGASAVTLGELEARACRAAWALKAELGGSASLRAREPAALLVLG
SQAIPALCVWLGLAKLGCPTAWINPHGRGTPLVHSVLSSGARVLVVDPDLWESLEEILPK
LQAENIRCFYLGHTSPTPGVGTLGAALDAAPSHPVPADLRAGITRRSPALFIYTSGTTGL
PKPAILTHERVLQMSKMLSLCGATADDVVYTVLPLYHVIGLVLGFLGCLDLGATCVLAPK
FSASCFWDDCRRHGVTVIQYVGELLRYLCNTPQRQEDRTHTVRLAMGNGLRADVWKAFQQ
RFGPIRIWEIYGSTEGNMGLVNYVGRCGALGKMSCLLRMLSPFELVQFDTVAEEPVRDSH
GFCIPVGLGESGLLLTKVASRHPFVGYRGPRELSERKLVRNVRQSGDVYYNTGDVLAMDD
EGFLYFRDRLGDTFRWKGENVSTREVEGVLSQVDFLQQVNVYGVCVPGCEGKVGMAAVQL
APGHTFDGQKLYRHVRAWLPAYATPHFIRIQDAVEVTSTFKLVKTRLVREGFNVAVVIDP
LFILDNQAQSFRPLTAEMYQAVCEGTWRI
NT seq 2070 nt   +upstreamnt  +downstreamnt
atgggtgtcaggcgacgactggccttgctgctgctgctgctgctgctctggggcttgggg
cagccagtgtggccagtggctatggccttggccctgcgctggctcctgggggatcccacg
tgctgtgtgctccttggcctggccatgctagcacggccctggttcagcccctgggtgtcc
catgggctgagcctggcagctgcggccctggcactaaccttgctgccggcacggctgccc
ccggggctacgctggctgccggctgatgtggccttcttggccaagatcctccagctgggc
ctgaatgtcagggcatgcttaggccgacagccaccctacacctttgtagacgccctcgag
cgacgagcacgagcgcagcctggcaaggcggtcttggtgtggaccgggcctggggccagc
gcagtcactctaggcgagctggaagcccgggcctgccgggccgcatgggccctgaaggct
gagctgggtggctctgcgagccttcgtgccagggagcctgctgccctcctggtgctgggt
tcccaggccattccagccctgtgtgtgtggctcgggctggctaagctgggctgcccaaca
gcctggatcaacccacatggccgggggacacccctggtgcactctgtgctgagctctggg
gcccgggtgctggtggttgacccagacctctgggagagtctggaggagatccttcccaag
ctgcaggccgagaacatccgctgcttctacctcggccatacctcccctacaccaggggtg
gggactctgggagctgccctggatgcagcaccctcccacccagtgcctgctgacctgcgt
gccgggatcacacggcgaagccctgccctcttcatctacacctcagggaccactggcctc
ccgaagccagccatcctcacccatgagcgggtactgcagatgagcaagatgctgtccttg
tgtggggccacagctgacgatgtggtttacacggtcctgcctctgtaccacgtgatagga
cttgtcctggggttcctcggctgcttagatctgggagccacctgtgtcctggcccccaag
ttctctgcttcctgcttctgggatgattgtcggcggcatggcgtgacagtgatccagtac
gtgggagagctcctgcggtatctgtgcaacactccccagcgacaagaggaccggacacac
acagtccgcctggcgatgggtaatggactccgggccgatgtgtggaaggccttccagcag
cgcttcggtcctattcggatctgggaaatctacggctccacggaaggcaacatgggctta
gtcaactatgtggggcgctgcggggccctgggcaagatgagctgcctccttcgaatgctg
tccccctttgagctggtgcagttcgacacggtggcggaggagcctgtgagggacagtcac
ggcttctgcatccctgtagggctaggggagtcggggcttctgctgaccaaggttgccagc
cgccatcccttcgtgggctaccgcggcccccgagagctgtcggaacggaagctggtgcgc
aacgtgcggcagtcgggcgacgtttactacaacaccggggacgtgctggccatggacgac
gaaggcttcctctacttccgcgaccgcctcggagacaccttccggtggaagggcgagaac
gtgtccacgcgcgaggtggagggcgtgttgtcgcaggtggacttcctgcagcaggtgaac
gtgtatggcgtgtgtgtgccagggtgtgagggtaaggtgggcatggctgccgtgcagcta
gcccccggccatactttcgacgggcagaagttgtaccggcacgttcgcgcttggctccct
gcctacgccaccccccatttcatccgcatccaggacgctgtggaggtcacgagcacgttc
aaactggtgaagacccgattggtgcgtgagggctttaacgtagcggtcgtgattgaccct
ctgtttatactggacaaccaggcccagtccttccggcccctgacggcagaaatgtaccag
gctgtgtgtgagggaacctggcggatctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036410
Entry
101036410         CDS       T04350                                 

Gene name
SLC27A2
Definition
(RefSeq) very long-chain acyl-CoA synthetase
  KO
K08746  solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04146  Peroxisome
sbq04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101036410 (SLC27A2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101036410 (SLC27A2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101036410 (SLC27A2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbq01004]
    101036410 (SLC27A2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbq02000]
    101036410 (SLC27A2)
Enzymes [BR:sbq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     101036410 (SLC27A2)
    6.2.1.-  
     101036410 (SLC27A2)
Lipid biosynthesis proteins [BR:sbq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101036410 (SLC27A2)
Transporters [BR:sbq02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   101036410 (SLC27A2)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 101036410
NCBI-ProteinID: XP_003929071
LinkDB
Position
Unknown
AA seq 619 aa
MLPAIYTVLAGLLFLPLLVNLCCPYFFQDMSYFLQVASVARRVRSYGQRRPVRTILREFL
EKARQTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALFMGNEPAYVWL
WLGLVKLGCAMACLNCNIRAKSLLHCFQCCGAKVLLASPELQAAVEEILPSLQKDVSIYY
VSRTSNTDGVHSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGLPKAAVINHHR
IWYGTGLTSVSGLKADDVIYVTLPLYHSAALMIGIHGCIVAGATLALRSKFSASQFWDDC
RKYNVTVIQYIGELLRYLCNSPQKPNDHDHKVRLAVGNGLRGDVWKQFVKRFGDIHIYEF
YAATEGNIGLLNYTRKVGAVGRVNYLQKKVISYDLIKYDVEKDEPVRDENGYCVKVPKGE
VGLLVCKITQLTPFSGYAGGKAQTEKKKLRDVFKKGDLYFNSGDLLMVDRENFIYFHDRV
GDTFRWKGENVATTEVADIIGLLDFVQEVNVYGVHVPGHEGRIGMASIKMKENHEFDGKK
FFQHIADYLPSYARPRFLRMQDTIEITGTFKHCKVTLVEEGFNPSVIKDALYFLDDTAKS
YVPMTEDIYNAVSANSLKL
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgctgcccgccatctacacggttctggcggggctgctgttcctgccgctcctggtgaat
ctctgctgtccctacttcttccaggacatgagctacttcttgcaggtggcctccgtggcc
cggcgggtgcgcagctatgggcagcggcggccggtgcgcaccatcctgcgggagttcctg
gaaaaagcgcgccagactccacacaagccttttctgcttttccgcgacgagactctcacc
tatgcgcaggtggaccggcgcagcaaccaggtggcccgggccctccacgaccacctcggc
ctgcgccagggagactgcgtggcgctcttcatgggtaatgagcccgcctacgtgtggctg
tggctggggctggtcaagctgggctgtgccatggcgtgcctcaattgcaacatccgtgcg
aagtccctgctgcactgcttccagtgctgcggggcgaaggtgctgctggcgtcgccagaa
ctacaagcagctgttgaagagatactgccaagccttcaaaaagatgtgtccatctattat
gtgagcagaacctctaacacagatggggttcactctttcctggacaaagtggatgaagta
tcaactgaacctatcccagagtcatggaggtctgaagtcactttttccactcctgcctta
tacatttacacttctggaaccacaggtcttccaaaagcagccgtgatcaatcatcatcgc
atatggtatggaactggcctcactagtgtaagcggattgaaagcagatgatgtcatctat
gtcactctgcccttgtaccacagtgctgcactaatgattggcatccacggatgtattgtg
gctggtgctactcttgccttgcggtctaaattttcagccagccaattttgggatgactgc
agaaaatacaacgtcactgtcattcagtatattggtgaactgcttcggtatttatgcaac
tcaccacagaaaccaaatgatcatgatcataaagtgagactggcagtgggaaatggctta
cgaggagatgtgtggaaacaatttgtcaagagatttggggacattcacatctatgagttc
tatgctgccactgaaggcaatattggacttctgaattatacgagaaaagtcggtgctgtt
ggaagagtaaactacctacagaaaaaagtcatatcttatgacctgattaaatatgatgtc
gagaaagatgaacctgtccgtgatgaaaatggatattgcgtcaaagttcccaaaggtgaa
gttggacttctggtttgcaaaatcacacaacttacaccatttagtggctatgctggggga
aaggctcagacagagaagaaaaaactgagagatgtctttaagaaaggagacctctatttc
aacagtggagatctcttaatggttgaccgtgaaaatttcatctatttccacgacagagtt
ggagatacattccggtggaaaggagaaaacgtggccaccactgaagttgctgatataata
ggactgcttgattttgtccaagaagtgaatgtttacggagtgcatgtgccaggtcatgag
ggtcgcattggcatggcctccatcaaaatgaaagaaaaccacgaatttgatggaaagaaa
ttctttcagcacattgctgattatctgcctagttatgcaagaccccggtttctaagaatg
caggacaccattgagatcactggaacttttaaacactgcaaagtgaccctcgtggaggag
ggctttaacccctctgtcatcaaagatgccttgtatttcttggacgacacagcaaaatcg
tatgtgcctatgactgaagacatctataatgccgtaagtgctaacagcctgaaactctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037455
Entry
101037455         CDS       T04350                                 

Gene name
SLC27A4
Definition
(RefSeq) long-chain fatty acid transport protein 4
  KO
K08745  solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04931  Insulin resistance
sbq04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101037455 (SLC27A4)
  09154 Digestive system
   04975 Fat digestion and absorption
    101037455 (SLC27A4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101037455 (SLC27A4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbq01004]
    101037455 (SLC27A4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbq02000]
    101037455 (SLC27A4)
Enzymes [BR:sbq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     101037455 (SLC27A4)
Lipid biosynthesis proteins [BR:sbq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101037455 (SLC27A4)
Transporters [BR:sbq02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   101037455 (SLC27A4)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 101037455
NCBI-ProteinID: XP_010349699
LinkDB
Position
Unknown
AA seq 709 aa
MLLGASLVGVLLFSKLVLKLPWTQVGFSLLFLYLGSGGWRFIRVFIKTIRRDIFGGLVLL
KVKAKVRRYLRERRTVPILFASTVRRHPNKTALIFEGTDTHWTFCQLDDYSSSVANFLQA
RGLASGDVAALFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFG
SEMASAICEIHASLDPSLSLFCSGSWEPSAVPPSTEHLDPLLKDAPKHLPSRPDKGFTDK
LFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPDDIVYDCLPLYHSAGNIVGIGQ
CLLHGMTVVIRKKFSASRFWDDCVKYNCTIVQYIGELCRYLLNQPPREVENQHQVRMALG
NGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVR
VNEDTMELIRGPDGVCIPCQPGLPLGGQRGRDWLEKEEGQVCADGEPCSDQWPSLSSALR
AASYSFLCVSTHSFIHHSIFSRTDIVGSVCPTCPDELLGLGRVGHFCGKQRDSSQIKMQK
LASPSPASSSPSLGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADV
AVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLAKELPLYARPIFLRLLPELHKTGTF
KFQKTELRKEGFDPAMVKDPLFYLDARKGRYIPLDREAYSRIQAGEEKL
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgctgcttggagcctctctggtgggggtgctgctgttctccaagctggtgctgaaacta
ccctggacccaggtggggttctccctgctgttcctctacttgggatctggtggctggcgc
ttcatccgggtcttcatcaagaccatcaggcgtgatatctttggcggcctggtgctcctg
aaggtgaaggcaaaggtacggcggtacttgcgggagcggcggacagtgcccattttgttt
gcctctaccgttcggcgccaccccaacaagacagccctaatcttcgagggcacagatact
cactggaccttctgccagctggatgactactcaagcagcgtggccaacttcctgcaggcc
cggggcctggcctcaggtgatgtggctgccctcttcatggagaaccgcaatgagttcgtg
ggcctatggctgggcatggccaagctcggtgtggaggcagcccttatcaacaccaacctg
cggcgggatgccctactccactgcctcaccacctcgcgcgcacgggcccttgtctttggc
agtgaaatggcctcagccatctgtgagatccatgccagcctggacccctcgctcagcctc
ttctgctctggctcctgggagcccagtgcagtgcctccaagcacagaacacctggatcct
ctgctgaaagatgctcccaagcacctgcccagtcgccctgacaagggcttcacagataaa
ctgttctacatctacacatcgggtaccacagggctgcccaaggctgccatcgtggtgcac
agcaggtattaccgcatggctgccctggtgtactatggatttcgcatgcggcctgacgac
atcgtctatgactgcctccccctctaccactcagcaggaaacattgtgggaattgggcag
tgcctgctgcacggcatgacggtggtgatccggaagaagttctcagcctcgcggttctgg
gatgattgtgtcaagtacaactgcacgattgtgcagtacattggtgaactgtgccgctac
ctcctgaaccagccaccgcgggaggtggaaaaccagcaccaggttcgcatggcactaggc
aacggcctccggcagtccatctggaccaacttttccagccgcttccacataccccaggtg
gctgagttctacggggccacagagtgcaactgcagcctgggcaactttgacagccaggtg
ggggcctgtggcttcaacagccgcatcctgtccttcgtgtaccccatccggttggtacgt
gtcaacgaggacaccatggagctgatccgggggcccgatggcgtctgcattccctgccag
ccaggtctgccacttgggggtcagagagggagggactggcttgagaaggaagaaggccag
gtgtgtgcagatggggagccctgttctgaccagtggccatcacttagctctgctcttagg
gctgcaagttactcatttctttgtgtatccacccattcattcattcaccattctatcttt
tcaagaacagacatcgttggctcagtgtgtccgacctgcccagatgagctcctggggttg
gggagggtggggcatttctgtggcaagcagcgtgactcaagtcagatcaagatgcagaag
ttggccagccccagccctgcctcatccagcccctccctaggtgacgtcctggtgatggat
gagcttggctacctgtacttccgagaccgcacgggggacacgttccgctggaaaggtgaa
aacgtgtccaccaccgaggtggaaggcacactcagccgcctgctggacatggctgacgtg
gctgtgtacggtgttgaggtgccaggaaccgagggccgggccggaatggctgccgtggcc
agccccactggcaactgtgacctggagcgttttgctcaggtcctggcaaaggaactgccc
ctgtatgcgcgccctatcttcctgcgcctcctgcctgagctgcacaaaacagggaccttc
aagttccagaagacagagctacgtaaagagggctttgacccggctatggtgaaagacccg
ctgttctatctagacgcccggaagggccgctacatcccgctggaccgagaggcctacagc
cgcatccaggcaggagaggagaagctgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048142
Entry
101048142         CDS       T04350                                 

Gene name
SLC27A6
Definition
(RefSeq) long-chain fatty acid transport protein 6
  KO
K08749  solute carrier family 27 (fatty acid transporter), member 6
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101048142 (SLC27A6)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101048142 (SLC27A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbq02000]
    101048142 (SLC27A6)
Transporters [BR:sbq02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   101048142 (SLC27A6)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 101048142
NCBI-ProteinID: XP_010337427
UniProt: A0A2K6TQ82
LinkDB
Position
Unknown
AA seq 619 aa
MLLSWLTVLGAGMVVLHCLQKLLCPYFWDDFWFLSKVVLVGIRLEKYKKRGELVTVLDKF
LCHAKRQPRKPFIIYEGDVYTYQDVDKRSSRVAHVFLNHSSLKKGDTVALLMSNEPDFIH
VWFGLAKLGCVVAFLNSNIRANSLLNCIRTCGPTALVVGADLLGTVEEILPSLPEDISVW
GMKDSVPQGIISLKEKLDTSSDEPVPRSHHVVSCLKSTCLYIFTSGTTGLPKAAVISQLQ
VLRGSAALWAFGCTADDIVYITLPLYHSSGAILGISGCVELGATCVLKKKFSASQFWGDC
KKYDVTVFQYIGELCRYLCKQPKREGEKDHKVRLAIGNGIRSDVWREFLDRFGNIKVCEL
YGATEANISFMNHTGKIGAVGRTNFFYKLLFTFDLIKFDFQKDEPMRNEQGWCIHVKKGE
PGLLISRVHAKNPFFGYAGSYKHTKSKLLCDVFKKGDVYLNTGDLIVQDQDNFLYFWDRT
GDTFRWKGENVATTEVADVIGMLDFIQEANVYGVAISGYEGRAGMASIILKPNESLDLEK
LYEQVVTSLPAYACPRFLRIQEKMETTGTFKLLKYQLVKEGFNPLKISDPLYFMDNLKKS
YVSLTREIYDQIMLGEIKL
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgcttctgtcatggctaacagttctaggggccggaatggtcgtcctgcactgcctgcag
aaactcctgtgcccttacttttgggatgacttctggttcctgtcgaaggtggtgctcgtt
ggaattcgcctggagaagtataaaaagagaggggagctggtgactgtgctggataaattc
ttgtgtcatgccaaaaggcaacctcggaaacctttcatcatctatgagggagacgtctac
acctatcaggatgtagacaaaaggagtagcagagtggctcatgtcttcctgaaccattcc
tcgctgaaaaagggggacacagtggctctgctgatgagcaatgagccggacttcattcac
gtgtggttcgggctggcgaagctgggctgcgtggtggcctttctgaactccaacattcgc
gccaattccctcctgaattgcatccgcacctgtgggcccacggccctagtggtgggcgca
gatttgcttggaactgtagaagaaatccttccaagcctcccagaagatatcagtgtttgg
gggatgaaagattctgttccacaaggcataatttcactcaaagagaaactggacacctca
tctgatgagcccgtgccacgcagccaccatgttgtctcatgcctcaagtctacttgtctt
tacatttttacctctggaacaacaggtttgccgaaagcagctgtgattagtcagctgcaa
gttttaaggggttctgctgccctgtgggcttttggttgtactgctgatgacattgtttat
ataaccctgcctctgtatcatagttccggagctatcctgggaatttctggatgtgttgag
ttgggtgccacttgtgtgttaaaaaagaaattctcagcaagtcagttttggggtgactgc
aagaagtatgatgtgactgtgtttcagtacattggagaactttgtcgctacctttgcaaa
caacctaagagagaaggagaaaaggatcataaagtgcgtttggcaattggaaatggcata
cggagtgatgtctggagagaatttttagacagatttggaaatataaaggtgtgtgaactt
tatggagctactgaagcaaacatatctttcatgaaccacactgggaaaattggagcagtt
gggagaacaaatttcttttacaaacttcttttcacttttgacttaataaagtttgatttt
cagaaagatgaacccatgagaaatgaacaggggtggtgtattcacgtgaaaaaaggggaa
cctggacttctcatttctcgagtgcatgcaaaaaatcctttctttggctatgctgggtct
tacaagcacacaaaaagcaaattgctttgtgatgttttcaagaagggagatgtttacctt
aacactggagacttgatagtccaggatcaggacaatttcctttatttttgggaccgtact
ggagacactttcagatggaaaggagaaaatgttgcaaccacagaggttgctgatgttatt
ggaatgttggatttcatacaggaagcaaacgtctatggtgtggctatatcaggttatgaa
ggaagagcaggaatggcttctattattttaaaaccaaatgaatctttagatttggaaaaa
ctttatgaacaagttgtaacatctcttccagcttatgcatgtccacgatttttaagaatt
caggaaaaaatggaaacaacaggaacattcaaactattgaagtatcagttggtgaaagaa
ggatttaatccactgaaaatttctgatccactttacttcatggataacttgaaaaagtcc
tatgtttcattgaccagggaaatttatgatcaaataatgttgggggagataaaactttaa

DBGET integrated database retrieval system