KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101032922
Entry
101032922         CDS       T04350                                 

Gene name
SLC27A1
Definition
(RefSeq) long-chain fatty acid transport protein 1 isoform X1
  KO
K08745  solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04931  Insulin resistance
sbq04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101032922 (SLC27A1)
  09154 Digestive system
   04975 Fat digestion and absorption
    101032922 (SLC27A1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101032922 (SLC27A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbq01004]
    101032922 (SLC27A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbq02000]
    101032922 (SLC27A1)
Enzymes [BR:sbq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     101032922 (SLC27A1)
Lipid biosynthesis proteins [BR:sbq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101032922 (SLC27A1)
Transporters [BR:sbq02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   101032922 (SLC27A1)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C POTRA_2
Other DBs
NCBI-GeneID: 101032922
NCBI-ProteinID: XP_003942318
UniProt: A0A2K6UA63
LinkDB
Position
Unknown
AA seq 646 aa
MRAPGAGTASVVSLALLWLLGLPWTWSAAAALGVYVGSGGWRFLRIVCKTARRDLFGLSV
LIRVRLELRRHQRAGHTVPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLF
LQLGFVPGDVVAVFLEGRPEFVGLWLGLAKAGVEAALLNVNLRREPLAFCLGTSGAKALI
FGGEMAAAVAEVSGHLGKSLIKFCSGNVGPEGVLPDTHLLDLMLKEASTAPLAQIPSKGM
DDRLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGHHAYCMQAADVLYDCLPLYHSAGNIIG
VGQCLIYGLTVVLRKKFSASSFWDDCVKYNCTVVQYIGEICRYLLKQPVREAERRHRVRL
AVGNGLRPAIWEEFTQRFGVRQIGEFYGATECNCSIANMDGKVGSCGFNSRILPHVYPIR
LVKVNEDTMELLRDTRGLCIPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKIAHSV
FSKGDSVYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVY
GVAVPGVEGKAGMAAIADPQSLLDPNAMYQELQKVLAPYARPMFLRLLPQVDTTGTFKIQ
KTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGTFSL
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgcgggctccgggtgcgggcactgcctcggtggtctcgctggcgctcttgtggctgctg
ggcttgccgtggacctggagcgcggcagcggcgctcggcgtgtacgtgggcagcggcggc
tggcgcttcctgcgcatcgtctgcaagacggctaggcgagacctcttcggtctctctgtg
ctgatccgcgtgcgcctggagctgcggcggcaccagcgcgccggccacacggtcccgcgc
atctttcaggcggtggtgcagcggcagcccgagcgcctggcactggtggacgccgggacc
ggcgagtgctggactttcgcgcagctggacgcctactccaatgcggtggccaacctcttc
ctccagctgggctttgtgccgggtgacgtggtggccgttttcctggagggccggcccgag
ttcgtggggctgtggctgggcctggccaaggcgggcgtggaggccgcactgctcaacgtg
aacctgcggcgcgaacccctggccttctgtctgggcacctcgggcgccaaggccctcatc
tttggtggagaaatggcagcggcggtggccgaagtgagcgggcatctggggaaaagtttg
atcaagttctgctccggaaacgtggggcctgagggcgtcttgccggacacccacctcctg
gacctgatgctgaaggaggcctccactgcccctttggcacagatccccagcaagggcatg
gacgatcgtcttttctacatctacacgtcggggaccacggggctgcccaaggctgccatc
gtcgtgcacagcaggtactaccgcatcgcagccttcggccaccacgcctactgcatgcag
gcggctgacgtgctctatgactgcctgcccctgtaccactccgcagggaacatcataggt
gtgggacagtgtctcatctatgggctgacagtcgtcctccgcaagaaattctcggccagc
agcttctgggacgactgcgtcaagtacaactgcacggtggttcagtacattggggagatc
tgccgctacctgctgaagcagccggtgcgcgaggcggagaggcgacaccgcgtgcgcctg
gcggtggggaacggtctgcgtcccgccatctgggaggagttcactcagcgcttcggcgtg
cgccagatcggggagttctacggcgccacggagtgcaactgcagcattgccaacatggat
ggcaaggtcggctcctgtggtttcaacagccgcatcctgccccacgtgtaccccatccgg
ttggtgaaggtcaatgaggacacgatggagctgttgcgggatacccggggcctctgcatc
ccctgccaggccggggagcccggcctcctcgtgggtcagatcaaccagcaggacccgctg
cgccgcttcgacggctatgtcagcgagagcgcgaccagcaagaagatcgcccacagcgtc
ttcagcaagggcgacagcgtctatctctcaggtgacgtgctggtgatggatgagctgggc
tacatgtacttccgggaccgcagcggggataccttccgctggcgaggggagaacgtctcc
accaccgaggtggagggtgtcctgagccgcctgctgggccagacagacgtggccgtctat
ggggtggctgttccaggagtggagggtaaggcagggatggcggccatcgcggatccccag
agcctgctggaccccaatgcgatgtaccaggagctgcagaaggtgctggcgccctatgcc
cggcccatgttcctgcgcctcctgccccaggtggacaccacaggcaccttcaagatccag
aagacgaggctgcagcgagagggctttgacccacgccagacctcggaccggctcttcttc
ctggacctgaagcagggccactacctgcccttgaacgaggcggtctacactcgcatctgc
tcgggcactttctccctctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037455
Entry
101037455         CDS       T04350                                 

Gene name
SLC27A4
Definition
(RefSeq) long-chain fatty acid transport protein 4
  KO
K08745  solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04931  Insulin resistance
sbq04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101037455 (SLC27A4)
  09154 Digestive system
   04975 Fat digestion and absorption
    101037455 (SLC27A4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101037455 (SLC27A4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbq01004]
    101037455 (SLC27A4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbq02000]
    101037455 (SLC27A4)
Enzymes [BR:sbq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     101037455 (SLC27A4)
Lipid biosynthesis proteins [BR:sbq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101037455 (SLC27A4)
Transporters [BR:sbq02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   101037455 (SLC27A4)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 101037455
NCBI-ProteinID: XP_010349699
LinkDB
Position
Unknown
AA seq 709 aa
MLLGASLVGVLLFSKLVLKLPWTQVGFSLLFLYLGSGGWRFIRVFIKTIRRDIFGGLVLL
KVKAKVRRYLRERRTVPILFASTVRRHPNKTALIFEGTDTHWTFCQLDDYSSSVANFLQA
RGLASGDVAALFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFG
SEMASAICEIHASLDPSLSLFCSGSWEPSAVPPSTEHLDPLLKDAPKHLPSRPDKGFTDK
LFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPDDIVYDCLPLYHSAGNIVGIGQ
CLLHGMTVVIRKKFSASRFWDDCVKYNCTIVQYIGELCRYLLNQPPREVENQHQVRMALG
NGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVR
VNEDTMELIRGPDGVCIPCQPGLPLGGQRGRDWLEKEEGQVCADGEPCSDQWPSLSSALR
AASYSFLCVSTHSFIHHSIFSRTDIVGSVCPTCPDELLGLGRVGHFCGKQRDSSQIKMQK
LASPSPASSSPSLGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADV
AVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLAKELPLYARPIFLRLLPELHKTGTF
KFQKTELRKEGFDPAMVKDPLFYLDARKGRYIPLDREAYSRIQAGEEKL
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgctgcttggagcctctctggtgggggtgctgctgttctccaagctggtgctgaaacta
ccctggacccaggtggggttctccctgctgttcctctacttgggatctggtggctggcgc
ttcatccgggtcttcatcaagaccatcaggcgtgatatctttggcggcctggtgctcctg
aaggtgaaggcaaaggtacggcggtacttgcgggagcggcggacagtgcccattttgttt
gcctctaccgttcggcgccaccccaacaagacagccctaatcttcgagggcacagatact
cactggaccttctgccagctggatgactactcaagcagcgtggccaacttcctgcaggcc
cggggcctggcctcaggtgatgtggctgccctcttcatggagaaccgcaatgagttcgtg
ggcctatggctgggcatggccaagctcggtgtggaggcagcccttatcaacaccaacctg
cggcgggatgccctactccactgcctcaccacctcgcgcgcacgggcccttgtctttggc
agtgaaatggcctcagccatctgtgagatccatgccagcctggacccctcgctcagcctc
ttctgctctggctcctgggagcccagtgcagtgcctccaagcacagaacacctggatcct
ctgctgaaagatgctcccaagcacctgcccagtcgccctgacaagggcttcacagataaa
ctgttctacatctacacatcgggtaccacagggctgcccaaggctgccatcgtggtgcac
agcaggtattaccgcatggctgccctggtgtactatggatttcgcatgcggcctgacgac
atcgtctatgactgcctccccctctaccactcagcaggaaacattgtgggaattgggcag
tgcctgctgcacggcatgacggtggtgatccggaagaagttctcagcctcgcggttctgg
gatgattgtgtcaagtacaactgcacgattgtgcagtacattggtgaactgtgccgctac
ctcctgaaccagccaccgcgggaggtggaaaaccagcaccaggttcgcatggcactaggc
aacggcctccggcagtccatctggaccaacttttccagccgcttccacataccccaggtg
gctgagttctacggggccacagagtgcaactgcagcctgggcaactttgacagccaggtg
ggggcctgtggcttcaacagccgcatcctgtccttcgtgtaccccatccggttggtacgt
gtcaacgaggacaccatggagctgatccgggggcccgatggcgtctgcattccctgccag
ccaggtctgccacttgggggtcagagagggagggactggcttgagaaggaagaaggccag
gtgtgtgcagatggggagccctgttctgaccagtggccatcacttagctctgctcttagg
gctgcaagttactcatttctttgtgtatccacccattcattcattcaccattctatcttt
tcaagaacagacatcgttggctcagtgtgtccgacctgcccagatgagctcctggggttg
gggagggtggggcatttctgtggcaagcagcgtgactcaagtcagatcaagatgcagaag
ttggccagccccagccctgcctcatccagcccctccctaggtgacgtcctggtgatggat
gagcttggctacctgtacttccgagaccgcacgggggacacgttccgctggaaaggtgaa
aacgtgtccaccaccgaggtggaaggcacactcagccgcctgctggacatggctgacgtg
gctgtgtacggtgttgaggtgccaggaaccgagggccgggccggaatggctgccgtggcc
agccccactggcaactgtgacctggagcgttttgctcaggtcctggcaaaggaactgccc
ctgtatgcgcgccctatcttcctgcgcctcctgcctgagctgcacaaaacagggaccttc
aagttccagaagacagagctacgtaaagagggctttgacccggctatggtgaaagacccg
ctgttctatctagacgcccggaagggccgctacatcccgctggaccgagaggcctacagc
cgcatccaggcaggagaggagaagctgtga

DBGET integrated database retrieval system