KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033079
Entry
101033079         CDS       T04350                                 

Gene name
TERT
Definition
(RefSeq) telomerase reverse transcriptase
  KO
K11126  telomerase reverse transcriptase [EC:2.7.7.49]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101033079 (TERT)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101033079 (TERT)
   05226 Gastric cancer
    101033079 (TERT)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101033079 (TERT)
   05165 Human papillomavirus infection
    101033079 (TERT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sbq03032]
    101033079 (TERT)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     101033079 (TERT)
DNA replication proteins [BR:sbq03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    101033079 (TERT)
   Telomerase complex (fungi)
    101033079 (TERT)
SSDB
Motif
Pfam: Telomerase_RBD RVT_1
Other DBs
NCBI-GeneID: 101033079
NCBI-ProteinID: XP_010341396
UniProt: A0A2K6U909
LinkDB
Position
Unknown
AA seq 1096 aa
MSPPPATWERTSVWVTELGAASHPELWWLPAPARAPPAGDSGRFPRPQVSPLKELVARVL
QRLCERGARNVLAFGFALLDGAGGGPPEAFTTSVRSYRPNTVTETLRGSGAWALLLRRLG
DDVLVYLLAHCALYVLVAPSCAYQVCGPPLYELRAAPEPQPAPHAAGTRRGLGRERAWSS
SVREPGVRPGLPAPGGRRRRGSASVSPPWPKRPRCGPAPEPEPTPVGQGSRAHRGRARGP
SGHGFCVVSPAGAAKKAPGSCHSYPSAGRQPAAGPPSTSRSPQPRDTRCPLVYAETKHFL
YSSGAQERLRPSFLLSALRPSLTGARRLLDTIFLGSRPGTPRRLPRLPQRYWQMRPLFLE
LLGNHARCPYGALLKTHCPLRTAVTPAARVCAQKPLGSVAAPEEEDTDPRRLVQLLRQHS
SPWQVYGFLRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSLQELTWKMRVRD
CTWLRRSPGVGSVPAAEHRLREEILAKFLHWLMGVYVVELLRSFFYVTETTFQKNRLFFY
RKSVWSKLQSIGIRQHLQRVQLRELSDAEVRRRREARPALPTSRLRFLPKPDGLRPIVNM
DYVVGARTFRREKRAQRPTSRVKVLFSVLNYERARQPGLLGASVLGLDDIHRAWRDFVLH
MRARDPPPELYFVKVDVTGAYDTIPQDKLVEVIASIIRPQATYCVRRYAVVQKAAHGHVR
KAFKSHVSTLADLQPYMRQFVARLQETSSLRDSVVIEQSSSLNEASSGLFDVFLRFVCNH
VVRIGGKSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRQDGLLLRLVDDFLLVTPH
LSHAKAFLRTLVQGIPEYGCVVNLRKTVVNFPVDDEALGSAVFVQLPAHGLFPWCGLLLD
TRTLEVQSDFSSYAGTSIRASLTFNRSFQAGRSMRRKLFGVLRLKCHSLFLDLQVNSLQT
VCTNIYKTFLLQAYRFHACVLQLPFQQQVWKNPAFFLRVISDMGSLCYSILKAKNAGTSL
GAKGAAGPLPSEAVHWLCRRAFLLKLSRHRVTYAPLLGSLRTAQSQLSRKLLGTTLAALE
AVTSPALPSDFKTILD
NT seq 3291 nt   +upstreamnt  +downstreamnt
atgtcccctccccccgccacgtgggaacgaacatctgtctgggtcactgagctgggcgct
gccagtcaccctgagctatggtggctcccggcaccggcgcgcgcacccccggcgggcgac
tcagggcgctttccccgcccgcaggtgtcccccctgaaggagctggtggcccgggtgctg
cagaggctatgcgagcgtggcgcgaggaacgtgctggccttcggcttcgcgctgctggat
ggcgccggcggcggcccccccgaggccttcaccaccagtgtgcgcagctaccggcccaac
acggtgaccgagacgctgcgcggcagcggggcgtgggcgctgctgctgcgccgcctgggc
gacgacgtgctggtttacctgctggcgcactgcgcgctctacgtgctggtggctcccagc
tgcgcctaccaggtgtgcgggccgccgctgtacgagctccgcgctgcccccgagccccag
cccgcgccacacgcggctgggacgcgaaggggtctgggacgcgaacgggcctggagcagc
agcgtcagagagcccggggtccgcccgggcctgccagccccgggtgggagaaggcgccgg
ggcagtgccagtgtaagtccaccgtggcccaagaggcccaggtgtgggcctgccccggag
ccggagccgacgcctgtagggcagggatcccgggcgcaccggggcagggcgcgtggaccg
agcggccatggtttctgcgtggtgtcacctgccggagccgccaagaaagcccctggctca
tgccactcgtacccatcagcgggccgccagcctgcggcggggcccccatccacatcgcgg
tcaccgcagccccgggacacgcgttgtcccctggtgtatgccgagaccaagcacttcctc
tactcttcgggtgcccaggagcggcttcggccctccttcctactgagcgccctgcgcccc
agcctgacaggcgcccgcaggctcctggacaccatctttctgggttcgaggccagggacg
ccccgcaggctgccccgcctgccccagcgctactggcagatgcggcccctgtttctggag
ctgctcggaaaccacgcgcgttgcccctacggggcgctcctcaagacgcactgcccgctg
cggactgcggtcaccccagcggcccgagtctgtgcccagaagcccctgggctctgtggca
gcccccgaggaggaggacacagacccccgtcgcctggtgcagctgctccgccagcacagc
agcccctggcaggtgtacggcttcctgcgggcctgcctgcgccggctggtgccccccggc
ctctggggctccaggcacaacgagcgtcgcttcctcaggaacaccaagaagttcatctct
ctggggaagcatgccaagctctcgctgcaggagctgacctggaagatgagagtgcgtgac
tgcacttggctgcgcaggagcccaggggttggcagtgttccggctgcagagcaccgtctg
cgggaggagatcctggccaagtttctgcactggctgatgggcgtgtacgtggtggagctg
ctcagatcttttttttatgtcacggagaccacgtttcagaagaacaggctctttttctac
cggaagagtgtctggagcaagttgcagagcatcggaatcaggcagcacttgcagagggtg
cagctgcgggagctgtcagacgccgaggtccggcggcgtcgggaagccaggccggctctg
ccgacgtccaggctccgcttcctccccaagcccgacgggctgcggcctattgtgaacatg
gactacgtcgtgggagccagaacgttccgcagagaaaagagggcccagcgtcccacctcg
agagtgaaggtgctgttcagcgttctcaactacgagcgtgcgcggcagcccggcctcctg
ggcgcctccgtgttgggcctggacgacatccacagggcctggcgcgactttgtgctgcac
atgcgggccagggacccgccgcccgagctgtactttgtcaaggtggatgtgacaggcgca
tacgacaccatcccccaggacaagcttgtggaggtcattgccagcatcatcaggccgcag
gccacgtactgcgtgcggcggtatgctgtggtccagaaggccgcccacgggcacgtccgc
aaggccttcaagagccatgtgtccaccctggcggacctccagccgtacatgcggcagttt
gtggcccgcctgcaggagaccagctccctgagggatagcgtcgtcattgagcagagctcc
tccctgaatgaggccagcagcggcctgttcgacgtcttcctacgcttcgtgtgcaaccac
gtcgtgaggatcgggggcaagtcctacgtccagtgtcaggggatcccgcagggctccatc
ctgtccacactgctctgcagcctgtgctacggcgacatggagaacaagttgtttgccggg
attcggcaggacgggctgctgctgcgtttggtggatgacttcttgttggtgacacctcac
ctcagccacgcaaaagccttcctcaggaccctggttcaaggcatccctgagtatggctgc
gtggtgaacttgcggaagacggtggtgaacttccccgtggacgatgaggccttgggcagc
gcggtgtttgtccagctcccagcccatggcctgttcccctggtgcggcctgctgctggac
acccggaccctggaggtgcagagtgacttctccagctacgccgggacctccatcagagcc
agtctcaccttcaaccgcagcttccaggccgggaggagcatgcgtcgcaaactctttggg
gtcttgaggctgaagtgtcacagcctctttctggatttgcaggtgaacagcctccagacg
gtgtgcaccaacatctacaagaccttcctactgcaggcttacaggttccatgcgtgtgtg
ctccagctcccatttcagcagcaagtgtggaagaaccccgcgttctttctgcgcgttatc
tctgacatgggctccctctgctactccattctgaaagccaagaacgcagggacgtcactg
ggggccaagggcgcagccggcccgctgccctctgaggctgtgcactggctgtgccgccga
gccttcctgctgaagctgagtcgacaccgtgtcacctacgcgccgctcctggggtcgctc
aggacagcccagtcgcagctgagtcggaagctcctggggacgacgctggctgccttggag
gctgtcaccagcccggcgctgccctccgacttcaagaccatcctggactga

DBGET integrated database retrieval system