KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033122
Entry
101033122         CDS       T04350                                 

Gene name
IRF3
Definition
(RefSeq) interferon regulatory factor 3 isoform X1
  KO
K05411  interferon regulatory factor 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101033122 (IRF3)
   04621 NOD-like receptor signaling pathway
    101033122 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    101033122 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    101033122 (IRF3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101033122 (IRF3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101033122 (IRF3)
   05133 Pertussis
    101033122 (IRF3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101033122 (IRF3)
   05161 Hepatitis B
    101033122 (IRF3)
   05160 Hepatitis C
    101033122 (IRF3)
   05171 Coronavirus disease - COVID-19
    101033122 (IRF3)
   05164 Influenza A
    101033122 (IRF3)
   05162 Measles
    101033122 (IRF3)
   05168 Herpes simplex virus 1 infection
    101033122 (IRF3)
   05163 Human cytomegalovirus infection
    101033122 (IRF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101033122 (IRF3)
   05169 Epstein-Barr virus infection
    101033122 (IRF3)
   05165 Human papillomavirus infection
    101033122 (IRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101033122 (IRF3)
   04131 Membrane trafficking [BR:sbq04131]
    101033122 (IRF3)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    101033122 (IRF3)
Membrane trafficking [BR:sbq04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    101033122 (IRF3)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 101033122
NCBI-ProteinID: XP_010349389
UniProt: A0A2K6UTJ7
LinkDB
Position
Unknown
AA seq 427 aa
MGTPKPRILPWLELQLNLGQLEGVAWVNESRTRFRIPWKHGLRHDAQQEDFGIFQAWAEA
TGAYVPGRDRPDPPTWKRNFRSALNRKDGLRLADDRSKDPHDPHKIYEFVNSGVGDFSQP
DTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDSGPAGLAVAPEPYPQSLLSPSLDNPT
SFPNPEPSENPLRRLLVPGEEWEFEVTAFYRGRQVFQQTISCPGGLRLVGSEVADRMLPG
WPITLPDPGVSLTDKGVMSYVRHVLSRLGGGLALWRAGQQLWAQRLGQCHTYWAVSEELL
PNSGNGPDGEVPKDKEGSVLDLGPFIVDLITFTEGSGRSPRYTLWFCVGEPWPQDQPWTK
RLVMVKVVPTCLRALVELARAGGASSLENTVELHISNSHPLSLTSDQYKAYLKDLVEDMD
FQSPGEA
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgggaaccccaaagccacggatcctgccctggctggagttgcagctgaatctggggcag
ctggagggtgtggcctgggtgaacgagagccgcacgcgcttccgcatcccttggaaacac
ggcctacggcatgatgcacagcaggaggatttcggaatcttccaggcctgggccgaggcc
actggtgcttacgttcccgggagggataggccagacccgccaacctggaagaggaatttc
cgttctgccctcaaccgcaaagatggattacgtttagcagatgaccggagcaaggaccct
cacgacccacataagatctacgagtttgtgaactcaggagttggggacttttcccagcca
gacacctctccagacaccaatggcggaggcagtacttctgatacccaggaagacattctg
gatgagttactgggtaacatggtcttggccccactcccagattcgggaccagcaggcctg
gctgtagcccctgagccctaccctcagtccctgctgagccccagcttggacaatcccacg
tccttcccaaacccagagccctctgagaacccactgaggcggctgctggtgccgggggaa
gagtgggagttcgaggtgacagccttctaccggggccgccaagtcttccagcagaccatc
tcttgcccaggaggcctgcggctggtggggtctgaagtggcagacaggatgctgcctgga
tggcccatcacactgccagaccctggcgtgtccctgacagacaagggagtgatgagctac
gtgaggcatgtgctgagccgcctgggcggaggactggctctgtggcgggccggacagcag
ctctgggcccagcggctggggcagtgccacacatactgggcagtgagcgaggagttgctc
cccaacagtgggaatgggcctgatggcgaggtccccaaggacaaggaaggaagcgtgctc
gacctgggacccttcattgtagatctgattaccttcacggaaggaagtggacgctcacca
cgctataccctttggttctgtgtcggggagccatggccccaggaccagccgtggaccaag
aggctcgtgatggtcaaggttgtgcccacatgcctcagggccttggtagagctggcccgg
gcagggggtgcctcctccctggagaacacggtggaactgcacatttccaacagccaccca
ctctccctcacctccgaccagtacaaagcctacctgaaggacttggtggaggacatggat
ttccagagccctggggaggcctga

DBGET integrated database retrieval system