KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033270
Entry
101033270         CDS       T04350                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq04115  p53 signaling pathway
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq04932  Non-alcoholic fatty liver disease
sbq05010  Alzheimer disease
sbq05012  Parkinson disease
sbq05014  Amyotrophic lateral sclerosis
sbq05016  Huntington disease
sbq05017  Spinocerebellar ataxia
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05134  Legionellosis
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05222  Small cell lung cancer
sbq05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101033270
   04215 Apoptosis - multiple species
    101033270
   04115 p53 signaling pathway
    101033270
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101033270
  09162 Cancer: specific types
   05210 Colorectal cancer
    101033270
   05222 Small cell lung cancer
    101033270
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101033270
   05012 Parkinson disease
    101033270
   05014 Amyotrophic lateral sclerosis
    101033270
   05016 Huntington disease
    101033270
   05017 Spinocerebellar ataxia
    101033270
   05020 Prion disease
    101033270
   05022 Pathways of neurodegeneration - multiple diseases
    101033270
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101033270
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101033270
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101033270
   05134 Legionellosis
    101033270
   05152 Tuberculosis
    101033270
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101033270
   05161 Hepatitis B
    101033270
   05160 Hepatitis C
    101033270
   05164 Influenza A
    101033270
   05162 Measles
    101033270
   05168 Herpes simplex virus 1 infection
    101033270
   05163 Human cytomegalovirus infection
    101033270
   05167 Kaposi sarcoma-associated herpesvirus infection
    101033270
   05169 Epstein-Barr virus infection
    101033270
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101033270
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101033270
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 101033270
NCBI-ProteinID: XP_003927765
LinkDB
Position
Unknown
AA seq 105 aa
MGDAEKGKRIFIEKCSQCHTVEKGGKHKTGPNLHGLFGWKTGQTSGFTYTEANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKGEREDLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgctgaaaaaggcaagaggatttttattgagaagtgttcccaatgtcacacc
gtggaaaagggaggcaagcacaagactggacctaatctccatggtctctttgggtggaag
acaggtcagacctctggattcacttacactgaagccaataagaacaaaggcatcatctgg
ggagaggatacactgatggaatatttggagaatcccaagaagtatatccctggaacaaaa
atgatctttgtcggcattaagaagaagggagaaagggaagacttaatagcttatctcaaa
aaagctactaatgagtaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034412
Entry
101034412         CDS       T04350                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq04115  p53 signaling pathway
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq04932  Non-alcoholic fatty liver disease
sbq05010  Alzheimer disease
sbq05012  Parkinson disease
sbq05014  Amyotrophic lateral sclerosis
sbq05016  Huntington disease
sbq05017  Spinocerebellar ataxia
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05134  Legionellosis
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05222  Small cell lung cancer
sbq05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101034412
   04215 Apoptosis - multiple species
    101034412
   04115 p53 signaling pathway
    101034412
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034412
  09162 Cancer: specific types
   05210 Colorectal cancer
    101034412
   05222 Small cell lung cancer
    101034412
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101034412
   05012 Parkinson disease
    101034412
   05014 Amyotrophic lateral sclerosis
    101034412
   05016 Huntington disease
    101034412
   05017 Spinocerebellar ataxia
    101034412
   05020 Prion disease
    101034412
   05022 Pathways of neurodegeneration - multiple diseases
    101034412
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101034412
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101034412
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101034412
   05134 Legionellosis
    101034412
   05152 Tuberculosis
    101034412
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101034412
   05161 Hepatitis B
    101034412
   05160 Hepatitis C
    101034412
   05164 Influenza A
    101034412
   05162 Measles
    101034412
   05168 Herpes simplex virus 1 infection
    101034412
   05163 Human cytomegalovirus infection
    101034412
   05167 Kaposi sarcoma-associated herpesvirus infection
    101034412
   05169 Epstein-Barr virus infection
    101034412
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101034412
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101034412
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 101034412
NCBI-ProteinID: XP_003944766
LinkDB
Position
Unknown
AA seq 105 aa
MDDVEKGKRIFIQKCSQCHTMEKGSKHKTGPNLHGIFGRKTGQASGFTYTEANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKGEREDLIAYFKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atggatgatgttgagaaaggcaagaggatttttattcagaagtgttcccaatgtcacacc
atggaaaagggaagcaagcacaagactggacctaatctccatggtatctttggccggaag
acaggtcaggcctctggattcacttacactgaagccaataagaacaaaggcatcatctgg
ggagaggatacactgatggaatatttggagaatcccaagaagtatatccctggaacaaaa
atgatctttgtcggcattaagaaaaagggagaaagggaagacttaatagcttatttcaaa
aaagctactaatgagtaa

DBGET integrated database retrieval system