KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033308
Entry
101033308         CDS       T04350                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor-associated factor 6 isoform X1
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04120  Ubiquitin mediated proteolysis
sbq04140  Autophagy - animal
sbq04144  Endocytosis
sbq04380  Osteoclast differentiation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05222  Small cell lung cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101033308 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101033308 (TRAF6)
   04064 NF-kappa B signaling pathway
    101033308 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101033308 (TRAF6)
   04140 Autophagy - animal
    101033308 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101033308 (TRAF6)
   04621 NOD-like receptor signaling pathway
    101033308 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    101033308 (TRAF6)
   04657 IL-17 signaling pathway
    101033308 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101033308 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101033308 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101033308 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101033308 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101033308 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101033308 (TRAF6)
   05135 Yersinia infection
    101033308 (TRAF6)
   05133 Pertussis
    101033308 (TRAF6)
   05152 Tuberculosis
    101033308 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101033308 (TRAF6)
   05161 Hepatitis B
    101033308 (TRAF6)
   05160 Hepatitis C
    101033308 (TRAF6)
   05171 Coronavirus disease - COVID-19
    101033308 (TRAF6)
   05162 Measles
    101033308 (TRAF6)
   05168 Herpes simplex virus 1 infection
    101033308 (TRAF6)
   05169 Epstein-Barr virus infection
    101033308 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101033308 (TRAF6)
   05140 Leishmaniasis
    101033308 (TRAF6)
   05142 Chagas disease
    101033308 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101033308 (TRAF6)
   04121 Ubiquitin system [BR:sbq04121]
    101033308 (TRAF6)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101033308 (TRAF6)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101033308 (TRAF6)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    101033308 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX Med21 DUF16 U-box Tropomyosin_1 UPF0242 Spc29 PspA_IM30 Sina DUF1664
Other DBs
NCBI-GeneID: 101033308
NCBI-ProteinID: XP_003920048
UniProt: A0A2K6TWI5
LinkDB
Position
Unknown
AA seq 537 aa
MDKFFSRASDKQVTMSLLNCENSCGSSQSESDCCGAMASSCSAATKDDSVGGTASTGNLS
SSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCP
VDNEILLENQLFPDNFAKREILSLMVRCPNEGCLHKMELRHLEDHQVHCEFALMDCPQCQ
RPFQKCQINIHVLKDCPRRQVSCVNCAASMAFEDKEIHDQNCPLANVLCEYCNTVLIREQ
MPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLTLTP
APPTPEVWNFQETIHQLEGRLVRQDHQIRELTAKMETQGMYVNELRRTIRTLEDKVAEIE
AQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCAN
YISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIP
RNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDTGV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggataagttctttagcagagcaagtgataaacaagttactatgagtctactaaattgt
gaaaacagctgtggatccagccagtctgaaagtgactgctgtggggccatggccagctcc
tgtagcgctgcaacaaaagatgatagtgtgggtggaactgccagcacggggaacctctcc
agctccttcatggaggagatccaggggtatgatgtggagtttgacccacccctggaaagc
aagtatgaatgccccatctgcttgatggcattacgagaagcagtgcagacaccatgcggc
catagattctgcaaagcctgcatcataaaatcaataagggatgcaggtcacaaatgtcca
gttgacaatgaaatactgctcgaaaatcaactatttccagacaattttgcaaaacgcgaa
attctttctctgatggtgaggtgtccaaatgaaggttgtttgcacaagatggaactgagg
catcttgaggatcatcaagtacattgtgagtttgctcttatggattgtccccaatgccaa
cgtcctttccaaaaatgccaaattaatattcacgttctgaaggattgtccaaggagacag
gtttcttgtgtaaactgtgctgcatcaatggcatttgaagataaagagatccatgaccag
aactgtcctttggcaaatgtcctctgtgaatactgcaatactgtactcatcagagaacag
atgcctaatcattatgatctagactgccctacagccccaattccatgcacattcagtact
ttcggttgccatgaaaagatgcagaggaatcacttggcacgccacctacaggagaatacc
cagtcacacatgagaatgttggcccaggctgttcatagtttgagccttactttaactccc
gctcctcccacccctgaggtctggaatttccaggaaactattcaccagttagagggtcgc
cttgtaagacaagaccatcaaatccgggagctgactgctaaaatggaaactcagggtatg
tatgtaaatgagctgaggcgaaccattcgaacacttgaggacaaagttgctgaaattgaa
gcacagcagtgcaatggaatttacatttggaagattggcaactttggaatgcatctgaaa
tgtcaagaagaggagaaacctgttgtgattcacagccctggattctacacaggcaaacct
gggtataaactgtgcatgcgcttgcaccttcagttaccgactgctcagcgctgtgcaaac
tatatatccctttttgtccacacaatgcaaggagagtatgacagccacctcccttggccc
ttccagggtacaatacgccttacaattcttgatcagtctgaagcacctgtaagacaaaac
cacgaagagataatggatgccaaaccagagctgcttgctttccagcgacccacaatccca
cgtaacccaaaaggttttggctatgtaacttttatgcatctggaagccctaagacaaaga
actttcattaaggatgacacattattagtgcgctgtgaggtctccacccgctttgacatg
ggtagccttcggagggagggttttcagccacgaagtactgatacaggagtatag

DBGET integrated database retrieval system